Protein

Protein accession
5r2Wt [EnVhog]
Representative
8DURc
Source
EnVhog (cluster: phalp2_17823)
Protein name
5r2Wt
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MTWENFNLDEFACRHCGKNLISHNLVDRLQSLRTELAFPFVITSGYRCPEHPNEINKSKVGTHAMGLAVDILSYGEQAYKIIATAPKHGFTGIGVNQKGQGRFIHLDIADETHGKQRPTVWSY
Physico‐chemical
properties
protein length:123 AA
molecular weight:13855,6 Da
isoelectric point:7,80
hydropathy:-0,39
Representative Protein Details
Accession
8DURc
Protein name
8DURc
Sequence length
63 AA
Molecular weight
6748,57480 Da
Isoelectric point
9,98978
Sequence
httgkaadisvargdafyllslalqkgftgigiaqkgsgasrfihldtientkgrprptvwsy
Other Proteins in cluster: phalp2_17823
Total (incl. this protein): 248 Avg length: 102,6 Avg pI: 7,89

Protein ID Length (AA) pI
8DURc 63 9,98978
12sss 137 9,14453
12xrt 99 6,39680
13L6f 150 6,52423
14Ppr 134 7,66038
15Uix 119 6,94677
16BI5 123 9,56674
16mAX 124 8,32463
17smR 104 9,69600
1A6L0 123 7,81745
1ABnf 93 9,57815
1ApdD 123 7,08824
1Eze2 126 6,05281
1HPvF 96 9,62341
1JXh0 81 9,13899
1KjP 48 8,11317
1PhHv 83 9,21061
1SG5O 125 6,58323
1SwtY 82 8,88879
1TbfG 84 9,46372
1TpCh 133 7,79038
1V4sd 126 8,86790
1VzJi 124 7,64924
1W5yt 119 6,50434
1WrPt 132 9,65184
1cbke 34 11,72301
1ffmG 123 7,79773
1fonk 123 7,79798
1gKY5 104 9,16542
1gswU 66 8,86764
1hcS5 143 8,29832
1spMa 129 9,43870
1szB 83 6,37429
1tXMi 125 6,28954
1vJHr 31 9,97850
1w2Qq 126 6,28357
1wM9A 119 6,50360
1wvm5 128 5,22921
1xfVp 80 8,16571
1y7bp 51 8,30825
22mzy 61 4,99975
22vS9 91 7,08273
29zM1 134 9,34355
2AUKH 73 9,34477
2B4ef 51 8,90955
2GkJt 119 6,50615
2HvW2 102 9,23447
2IYoS 72 7,38813
2J2A8 72 7,38813
2K8Xc 50 9,51549
2KAZL 43 8,43377
2L9iA 144 8,55252
2LaAS 62 6,02808
2MBXt 69 6,27999
2O8mp 122 9,17071
2OM3e 43 6,03712
2PMdO 119 6,94626
2PueK 81 9,91493
2Q8AJ 104 9,25922
2TCUT 103 6,89903
2TEBn 134 9,46275
2XB2F 44 4,95286
2Z4ls 117 9,24639
2dWbn 89 7,12348
2qhIB 144 8,63440
2vD38 58 9,74293
2vNiI 125 5,94777
2vtGT 70 7,16105
2w5Ha 132 9,62495
2wECX 82 7,96612
2wxRg 90 9,42600
2x2JN 69 6,91488
36sQV 56 5,50772
37TLg 116 8,54130
38zo3 38 8,59739
39TWx 90 6,45915
3ARRs 123 7,79798
3BH7E 53 9,51716
3D0vB 82 8,99007
3DN8Q 132 9,74486
3DRIj 73 8,97672
3FN0X 123 7,79798
3Fs1K 123 7,81165
3G3XH 123 7,82358
3GfTh 125 7,80643
3HL1d 123 7,04999
3HLms 125 8,52151
3HRR7 86 6,15813
3Hh0m 87 10,27976
3IQbM 128 5,41490
3ISBn 125 5,94777
3ImS8 133 7,70790
3JnfN 132 9,44966
3K30F 120 7,18135
3K3Jl 123 7,79798
3KUyF 132 9,53566
3L6pr 123 7,79798
3M1Dm 82 8,93185
3RvPe 38 6,03638
3Ts7o 126 9,13996
3Z6zy 123 5,77026
3ZocB 123 5,52631
3rNe2 125 6,28954
41W3E 95 9,81816
42ROE 67 6,05002
42XO8 126 6,43027
43iBa 123 5,78481
48tzm 142 6,96058
4Ba22 145 8,35144
4DJMu 124 9,05931
4DQsv 122 9,15453
4F99 53 4,99969
4FFIv 65 9,98875
4GOjf 33 8,59617
4H7x6 123 6,49922
4ItMk 91 6,63438
4PEcY 42 7,97714
4Pg8n 78 8,34293
4QKv7 73 6,31427
4RZvW 133 8,76959
4UDUd 77 9,77194
4Xj2G 93 8,97672
4ZbNI 89 9,51368
4iW2u 132 8,89704
4jFVZ 139 9,22048
4v2OS 123 7,81165
4vcFA 65 7,14986
54nGe 81 9,13899
5A28i 49 8,60713
5Ilur 89 10,12001
5drtc 96 9,30023
5hirB 124 9,18102
5mt4L 93 8,95732
5pDDa 119 7,09165
5rMRo 123 7,81165
5rTjU 67 7,95948
5rq3N 86 9,01437
5s2tG 105 6,96058
5sm31 119 6,21349
5tf6K 128 4,91841
5y9tP 91 6,88919
6BqMD 94 6,45796
6C6V0 55 6,88601
6Gdl2 81 9,13899
6JDLI 42 6,51343
6LwmD 58 8,15411
6Ngig 125 6,36792
6OGmT 125 6,58323
6ONKV 123 5,52926
6OXZ5 100 8,61970
6OgQ7 116 6,66411
6Qg5H 80 6,80820
6VoaE 57 6,91483
7ECF1 128 5,07029
7Ere6 133 7,70370
7Es14 119 6,50615
7H338 55 8,18408
7Tdym 132 8,89382
7U5tR 125 6,28954
7Vz4X 124 9,20288
7ZMdQ 128 5,46015
7ZdH5 123 7,79798
7vKtA 66 8,15875
7vWM8 84 7,96373
7vWxA 84 6,81610
7vWyC 84 7,96373
7xbRX 124 8,91825
815v0 133 7,69955
81cDF 132 9,32253
81t7q 81 8,71311
81vF2 146 6,96058
82htx 123 8,53627
83Cce 128 7,81790
83m2F 123 7,08887
84XC3 86 9,72881
85FWA 128 7,93485
87Nw5 123 5,47350
8AMvy 71 9,47435
8Accp 93 6,26629
8Aj7U 87 8,90478
8B4Rf 119 6,50615
8BO71 99 8,82077
8BwFy 119 7,00156
8D0fI 51 8,43680
8DPFV 56 6,29642
8Dh0s 41 6,92023
8DzTZ 74 7,02009
8EtkV 132 9,71140
8F9H5 102 8,00744
8FBDJ 79 9,59594
8FQOr 96 8,90594
8FcFu 132 9,71140
8FmhX 119 6,50615
8FtZf 127 9,00174
8af44 115 9,05892
8bw1J 119 6,94785
8cO3r 123 7,79798
8cOkZ 123 7,83299
8cQwO 123 8,49811
8eCw3 133 8,32172
8gFyq 119 8,27782
8gVY0 123 7,80591
8hHZQ 128 6,58846
8kJwS 119 8,27782
8oCPE 110 10,01260
8pffb 119 6,50547
8tttG 123 7,79798
8vBWc 133 6,99645
8vfRf 133 6,94450
8w3cj 125 9,51252
8woyM 119 7,00259
8xilY 115 8,89814
8yIQg 140 6,50456
8yttZ 45 9,60220
8yulJ 131 5,33169
8yxn7 82 8,04309
8zJ2I 139 9,29391
8zK63 80 7,09313
8zrwO 100 9,85897
9hrm 122 9,32801
BiiX 103 8,89092
EcJr 52 8,18138
Im7c 108 7,85549
Ql2e 119 8,67991
RIsR 123 8,35041
WF8X 77 9,64951
WG0Y 119 7,00259
WNJT 119 7,00344
YyXa 50 9,39506
bUQy 127 5,22768
bhi7 100 9,20526
cwZr 92 7,10569
eLmw 125 9,51252
gIOl 49 6,03286
igLN 128 6,58846
pdwA 101 9,51078
qXr4 118 5,77788
rAid 132 9,71140
rh1l 96 8,90594
ruEf 125 6,36792
uBYX 129 9,22712
us49 127 5,63260
v0DH 133 8,33081
wh1q 119 6,58005
wr1A 33 5,48396
xgZe 126 9,25503
y9GT 73 9,30409
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_35227
6F1YM
1 37,9% 58 1.488E-14
2 phalp2_10833
4dL2Z
1 40,2% 67 1.488E-14
3 phalp2_8537
1yTAR
14 56,5% 46 1.382E-13
4 phalp2_15140
8FcGi
2 42,4% 66 8.691E-12
5 phalp2_29453
1v4FU
64 35,5% 59 1.429E-09
6 phalp2_16185
4BJ90
59 45,6% 57 2.706E-09
7 phalp2_28235
sNhK
400 29,6% 64 9.076E-08
8 phalp2_10151
fS2o
1 35,9% 64 2.367E-07
9 phalp2_27656
6CsXd
2 40,4% 47 1.171E-06
10 phalp2_12986
3jelY
5 27,4% 62 4.209E-06

Domains

Domains
Unannotated
Representative sequence (used for alignment): 8DURc (63 AA)
Member sequence: 5r2Wt (123 AA)
1 63 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8DURc) rather than this protein.
PDB ID
8DURc
Method AlphaFoldv2
Resolution 96.76
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50