Protein

Protein accession
5qXVo [EnVhog]
Representative
7Exor
Source
EnVhog (cluster: phalp2_46)
Protein name
5qXVo
Lysin probability
94%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKDLFYIFVVSCMMLLFTYQTICQKGERKELTKQIQERDLIIDSLTLEIDTLSQKLDIFNFQFLQKEWNSLLDAIIRVESRNDDSAHAVGEDAVGCLQIRKTMVDDVNRIIRKQGLWKVYTYEDRWDRVKSIEMFQIYTDYYGLVEAEEIARCWNGGPRGMNKEATVSYWEKVQKEINS
Physico‐chemical
properties
protein length:179 AA
molecular weight:21204,1 Da
isoelectric point:5,07
hydropathy:-0,38
Representative Protein Details
Accession
7Exor
Protein name
7Exor
Sequence length
174 AA
Molecular weight
20550,90370 Da
Isoelectric point
9,68504
Sequence
MDIIIRMNILKNKFIITIFVVFLILLLSNRNVSNPIETSYQSLPKVESNNKKVEVKIMKRNLDKLIKVLIRIESNGNVNAVNKITGASGCLQILPIMVEEVNRISKIKKYNLKFEWDDVWDLQKSIMMFKIYTNFYSKNESYEVISKRWNGGPTGEMKQSTEDYWNRVQRYLYK
Other Proteins in cluster: phalp2_46
Total (incl. this protein): 250 Avg length: 175,4 Avg pI: 7,38

Protein ID Length (AA) pI
7Exor 174 9,68504
12pPy 186 4,85072
14wo1 174 9,04171
15dUl 157 9,85685
17mAU 144 6,13659
1AoV4 163 5,61725
1I0WV 167 9,91480
1TBAt 176 8,49914
1UbuZ 169 6,20559
1UxIF 184 6,29193
1Wntr 172 9,00838
1cLRl 151 4,96434
1g89t 190 5,12855
1j9D0 164 9,65126
1juK9 167 9,97598
1o9fS 157 9,86845
1sFw0 194 4,97446
1sI9h 198 7,74166
1sIbp 181 4,65315
1tkqD 195 7,51397
1tsxF 188 5,17470
1tyyp 190 5,94942
1u6nn 192 5,26132
1uUCE 148 5,44651
1vZR1 180 4,50196
1w1jy 195 5,20721
1w260 190 4,87715
1w6bx 179 9,00689
1wINx 198 7,74166
1xqmG 176 9,38210
21m9L 177 8,31070
246K4 167 9,98050
24JJI 151 5,22370
26DCv 143 9,76233
26iC8 143 9,95071
28iig 143 9,91944
2ABqw 183 8,27988
2AIEl 192 6,14142
2AqCG 177 7,62764
2Asmt 190 6,51673
2K9Vw 161 4,55999
2KOtg 162 9,82094
2LCOk 162 8,46420
2QaPH 175 9,71914
2Qfld 162 9,79973
2Rx1z 176 5,19090
2S1x5 184 6,29915
2TEtV 176 9,51561
2ZfWW 184 8,39502
2aReg 177 5,17868
2dPFd 165 9,33136
2gG3h 174 9,40105
2gP2H 158 9,09638
2kYAK 167 4,80576
2l6cJ 149 7,81229
2t2RE 176 6,73419
2uIQD 176 9,69580
2vKpO 200 4,90301
2wMZU 171 6,13318
2xbcP 186 5,82500
2yHhf 191 4,91267
2yttS 194 4,88914
2ywda 180 8,27440
2zWW9 193 4,91404
2zbFa 183 6,15875
34bV0 160 5,35039
36QY7 167 9,92196
3AMGx 192 5,58360
3AQSs 176 9,15891
3BQs8 188 6,36093
3BUX8 163 6,62006
3E8Ww 188 5,36147
3HUX2 179 5,21744
3HqD7 198 4,49354
3I4oP 179 4,72971
3Irrw 170 4,69731
3JKAj 184 5,95067
3NyFh 184 5,52466
3OWQF 195 5,50550
3OWb6 177 9,51826
3QEUA 142 9,41279
3R6iL 160 9,49743
3RFxX 174 4,84560
3SqSg 162 9,49247
3TQwB 161 6,13511
3bQRc 193 9,26445
3eM0s 185 9,76420
40ama 175 6,95433
49Yho 168 9,79612
4BFDB 156 6,70259
4G4kq 170 9,62424
4L5Z3 148 4,91262
4PeFh 190 4,97326
4QoN 187 5,94146
4Saee 185 5,06040
4ehe9 163 10,06463
4jl3V 176 9,14627
4jw93 176 8,76849
4lgeV 163 9,72791
4mdf1 148 9,96238
4ncmj 168 10,01453
4odtl 166 9,73152
4odyT 169 4,98742
4rHBs 168 10,01453
4xGOc 170 5,33703
5A5Z4 173 9,53811
5ihqj 162 10,06082
5iljD 168 10,01453
5jYEm 156 4,84964
5jYbr 165 5,74241
5ksEy 168 9,88586
5pBja 185 7,57649
5s1XI 193 5,07881
5snfj 181 4,52696
5t42V 141 9,95020
5t9W3 176 9,54037
5u5E6 168 9,97888
5vhKy 162 10,21155
5yWb0 166 5,33726
6FYgH 176 9,62772
6GMjS 162 10,06611
6NMHb 176 9,03416
6TAg7 170 8,75418
6WhVh 150 9,16155
6Y8K7 168 9,97888
6yQuv 167 9,97753
6yZ19 174 10,00016
6z55X 145 9,89198
6zU4b 162 9,96941
6zaxX 162 10,00132
7DK8b 190 9,30016
7EBAO 178 6,89175
7ECkT 184 5,71865
7EFFl 176 6,13312
7Ewad 182 6,13375
7GTpA 188 5,32532
7GYc5 190 5,37597
7H4wC 192 6,14142
7HC2j 179 5,38006
7HxGr 187 5,68068
7HxKR 179 9,04525
7Iirv 170 8,76791
7SF2k 142 4,38032
7SGlY 193 4,78626
7SK1n 198 4,90534
7SPtc 186 8,29413
7SqQ7 186 5,91719
7TS7W 169 8,72826
7TjI1 177 9,22809
7UV06 184 6,42624
7Uoof 185 4,77012
7UvsJ 177 5,85074
7Uwrk 178 6,09970
7WgkV 183 8,48812
7WmJD 187 5,32464
7Wrth 169 8,72826
7X69M 162 9,96283
7ZINK 177 6,94586
7rszM 143 9,89462
81bnx 177 6,51673
836zp 192 5,60122
85ski 169 9,11198
86AMr 186 5,94743
88EXp 195 6,21002
88Sk9 157 4,92649
88jpE 185 4,97525
88lCq 173 9,00025
88yiw 174 6,07571
88ynG 172 7,63077
89IyJ 151 9,67408
89ihC 176 8,80562
89nCP 187 6,13807
8AvpH 186 5,91719
8BeSL 177 9,51826
8Bgp5 184 6,61801
8Bq0M 174 8,42365
8CVaz 169 6,75886
8Cw9 195 9,97037
8CwcQ 183 9,21294
8DOlf 167 5,71513
8DmoC 162 9,53773
8EEtc 169 8,95268
8EWnt 197 6,29670
8EqoE 159 6,75477
8Eu5Y 169 9,11198
8Fitk 182 5,43264
8G8D4 178 6,09970
8GcKf 169 6,20559
8bG64 182 4,91989
8bcv4 148 5,46049
8cBqI 183 4,62865
8fQvf 169 8,40295
8fYZ4 198 4,65707
8g5ly 177 8,66947
8gF2x 190 4,79973
8gFp3 201 4,63575
8gm5M 183 7,73769
8go7A 183 8,55349
8gpj9 184 8,45343
8gv3b 198 4,43972
8gwrj 198 4,40294
8hRtT 198 5,04193
8jJPb 178 5,71143
8jt26 189 6,61659
8l0i0 200 5,30412
8nJyq 196 4,72732
8nkZ5 168 9,94472
8o8RG 184 6,82167
8ogjL 162 10,37214
8pecM 185 5,10075
8rImK 189 4,71715
8sD0L 165 10,09783
8t0Jm 191 4,52509
8t1FU 166 10,02820
8tVu1 179 6,62120
8uEr8 141 6,04047
8uSK9 191 4,53612
8vI0G 169 9,22441
8vwWA 185 8,47406
8vx0A 183 6,21167
8w738 177 9,58060
8wn9 186 9,39461
8wxxs 177 9,51826
8xCyJ 187 7,64191
8xLc3 176 8,49914
8xNiy 176 8,80562
8xUoS 195 5,50550
8xdFD 169 8,72826
8xnax 192 6,14142
8yD8X 184 6,51349
8yQkM 177 7,62753
8ybdg 190 5,36136
8yqa8 169 9,22441
8zASJ 185 5,06040
8zRg2 176 9,15891
9BaI 178 9,34561
AKSq 158 9,67363
H8wB 151 9,65532
WEGD 177 10,40644
XRTQ 173 9,53811
Xobi 178 9,22486
csAo 202 9,33504
dR1V 160 6,08134
irlp 161 4,54157
ksO8 189 5,54518
sBiW 174 9,49279
sc0U 154 9,56770
v8S7 143 9,92538
vlG0 187 5,01459
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_9165
6AJjn
149 42,5% 127 4.580E-52
2 phalp2_20516
4eE8g
949 45,9% 111 1.694E-45
3 phalp2_23582
1f8D
174 50,0% 110 5.415E-44
4 phalp2_11808
8aeor
7 37,6% 125 6.724E-43
5 phalp2_13677
61fFV
187 43,8% 114 2.663E-40
6 phalp2_32105
6iaas
89 39,0% 105 5.073E-37
7 phalp2_3524
4udWf
232 40,1% 107 1.188E-32
8 phalp2_5196
3O9Fp
630 27,1% 195 5.717E-32
9 phalp2_23047
4ccMQ
55 33,6% 116 2.008E-28
10 phalp2_33104
4JGEd
92 26,7% 183 4.153E-26

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 7Exor (174 AA)
Member sequence: 5qXVo (179 AA)
1 174 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (7Exor) rather than this protein.
PDB ID
7Exor
Method AlphaFoldv2
Resolution 80.98
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50