Protein

Protein accession
5ppI9 [EnVhog]
Representative
1K6EI
Source
EnVhog (cluster: phalp2_38857)
Protein name
5ppI9
Lysin probability
97%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
RVPLEDGQFNALCSFVFNLGSGALQSSTLRRKINRGDYIGAANEFPRWVYAGGRKLKGLVRRREHERLMFIG
Physico‐chemical
properties
protein length:72 AA
molecular weight:8197,3 Da
isoelectric point:10,84
hydropathy:-0,39
Representative Protein Details
Accession
1K6EI
Protein name
1K6EI
Sequence length
60 AA
Molecular weight
6613,57030 Da
Isoelectric point
10,83419
Sequence
SFAFNAGLGNLQRSTIRMKANRGDWEGAAEAFMMWTKGGGRVLPGLVKRRQSEIALFLAE
Other Proteins in cluster: phalp2_38857
Total (incl. this protein): 191 Avg length: 62,1 Avg pI: 9,88

Protein ID Length (AA) pI
1K6EI 60 10,83419
15fWr 60 10,27595
161Jw 62 10,14270
1DLD1 61 10,10647
1HZKs 58 10,00912
1ILt5 73 9,91751
1JKJq 61 9,97315
1JXMv 76 4,72289
1Kbzo 47 10,23656
1KjeY 79 10,02898
1MiPv 78 10,17867
1Pbiu 50 9,98707
1QJ8D 43 9,98701
1aYBF 82 9,69677
1ewIc 27 10,18286
1ezHG 54 10,50662
1iF4g 42 10,15172
1pX4W 60 9,50846
1pY01 42 11,23434
1qgo9 42 10,87815
1rVIt 93 9,65815
1vHK0 44 9,22183
1wYTt 51 10,23734
1yhAJ 34 9,52071
1zkW9 48 10,28124
1zoRJ 46 10,10911
22QZE 50 10,40296
25t5X 49 9,81275
260XD 70 10,43713
283Il 43 10,01183
2AiN0 52 7,03464
2QnJf 44 9,22183
2RaL8 64 9,97695
2cWX2 50 9,77291
2cXXK 82 10,03478
2d469 68 10,57109
2lrWL 78 9,99204
2x1cP 72 11,25420
34xSS 51 9,81165
35YCq 59 8,33649
38dmm 82 9,50698
38kCS 66 9,81262
3OYDx 55 11,43542
3Ug32 62 10,28092
3UqS0 44 9,29977
3V1iE 53 9,16555
3Wc0S 55 10,27202
3WjxE 47 11,31003
3XCp1 44 9,39364
3XxkH 82 9,10643
44rU6 67 10,20420
4653t 91 10,02859
46EyS 53 10,58282
46z93 46 9,74009
47wLK 47 10,28092
49Ydv 70 9,30416
49ZhG 75 9,89301
4DFpT 82 10,47413
4GCMr 42 9,81507
4GGCR 63 10,38626
4JeFn 48 10,38626
4NCYH 87 10,34642
4NDfd 75 9,82577
4NN1i 44 9,91796
4NOLL 43 8,19111
4Nk5c 73 9,91622
4YBiv 96 9,18115
4ZVxg 96 9,90352
4a1J2 35 9,85968
4a3td 59 10,16784
4aIFS 26 10,02511
4bAo9 60 9,69613
4bZsg 68 9,39138
4fyiZ 79 11,18109
4gXF6 41 9,74441
4lP3H 59 10,38626
4lmiT 70 10,35712
4lpiW 37 10,03097
4mKB2 40 10,24675
4mvOP 45 9,59929
4nT6x 78 10,27073
4o7Qb 100 9,72958
4ph8D 42 10,24611
4qgOn 42 8,34139
4rlS6 81 9,91416
4wm22 42 9,96154
4zqzS 62 10,13748
50skK 69 10,86997
50wAp 99 9,85923
538o9 45 8,08706
553dM 95 9,82371
56L72 33 9,51529
57l65 55 10,40296
57ry8 45 10,01228
58BMI 58 10,90330
58STK 44 9,69168
58aMO 49 9,85433
58gfK 96 9,18141
58whO 95 9,82371
5ATfg 85 10,21858
5AWDt 45 5,72036
5Cay3 64 10,55368
5CuK6 42 8,34139
5EocP 78 10,63227
5IPcN 74 10,35228
5aEYg 42 9,81739
5axay 42 9,81739
5csMi 42 9,96154
5d4YR 54 10,13915
5f1Q1 73 9,98720
5h3Zp 40 10,25694
5hm8j 80 11,18032
5ht0m 43 8,14089
5lwP5 42 10,62041
5mIE9 42 10,40786
5nSCw 99 9,75524
5nZPV 96 9,23369
5tla8 52 10,29233
5uVWE 45 8,08706
5uZs8 43 8,14089
5uprN 76 9,80972
5v3A7 96 9,20642
5vXxq 57 10,86642
5vh55 96 9,18141
5vopX 76 9,58724
5wGty 44 9,69168
5wHoD 33 9,98514
5wVTg 44 9,86613
5yrUY 44 10,14657
6AfJF 99 8,92786
6Asbq 32 9,51613
6AtHo 68 9,80604
6Ghjv 45 10,39657
6HiOH 71 9,51110
6IAYK 103 9,45231
6IKZC 46 9,74009
6IvbA 96 9,09651
6Kz79 96 9,54540
6LLf1 72 9,68981
6LYuI 61 9,77826
6MaSq 54 10,86636
6x6uq 70 10,62531
6xDLw 60 10,86636
6xUVO 62 10,14250
6xUp9 96 9,65725
6xUr0 72 9,80940
6xadD 56 10,21484
6xdQo 67 10,20420
6y4y7 65 10,38626
6yPSH 42 9,96154
6yPT1 44 10,14657
6yU6x 62 11,48222
6yZFZ 93 9,64810
6z2lS 42 9,96154
6zJFF 97 9,73261
7bfxa 90 5,77003
8CTrU 63 11,49099
8Dpz3 77 11,39641
8Eya 46 6,44312
8dlao 55 9,59813
8yMVh 76 10,84102
8zMZi 53 11,28604
DzEy 50 10,00854
E4Qq 44 11,90784
EeWe 92 10,46923
FMX9 53 10,14702
FYmh 65 9,56835
Fepp 45 9,39345
Fkkq 79 10,03639
GfGB 28 9,89843
Gj7G 72 9,81030
GoW1 48 10,50733
H7ps 31 9,11888
IRRK 93 9,94613
Knri 76 10,00390
L7KF 61 10,26132
LUgm 76 10,00390
LV9D 48 9,86690
MzQO 75 10,16371
MzeQ 77 9,72868
PdaU 53 10,40837
Qb1r 84 9,78006
RWY2 68 9,78245
TBRH 75 10,34120
Tf0b 84 9,77671
dIHT 83 10,85959
dt9s 55 10,36950
jL4v 69 9,51910
jOaO 73 10,25926
xtfJ 74 9,69019
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_19285
8enOZ
460 75,0% 60 3.310E-30
2 phalp2_7764
77796
37 55,0% 60 7.824E-25
3 phalp2_26702
2OTih
81 62,7% 51 1.475E-20
4 phalp2_17438
7Fv8C
39 51,7% 58 3.827E-20
5 phalp2_24173
2nDwl
15 44,8% 58 1.607E-17
6 phalp2_9294
7iwWK
82 63,8% 36 1.005E-15
7 phalp2_14837
7sNfr
34 42,5% 54 1.381E-15
8 phalp2_20456
3zJV8
14 45,9% 61 1.899E-15
9 phalp2_32235
7lNqs
1 42,6% 61 9.326E-15
10 phalp2_15074
7BwGK
4 37,2% 59 6.301E-14

Domains

Domains
Representative sequence (used for alignment): 1K6EI (60 AA)
Member sequence: 5ppI9 (72 AA)
1 60 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1K6EI) rather than this protein.
PDB ID
1K6EI
Method AlphaFoldv2
Resolution 97.02
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50