Protein
- Protein accession
- 5otHm [EnVhog]
- Representative
- 6a9a2
- Source
- EnVhog (cluster: phalp2_24701)
- Protein name
- 5otHm
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MPNLSAAIAAMDKACRIWSVGYDQGNRWDIRNGGETDCSALVIWALKQGGFDTGSATYTGNLSYNLTRRGWLRLPANLGVLQPGDILLNDTHHVCMVISGHGHSAIIAQASIDERGKASGGRAGDQTGYETNERRAYQYRHGWDCILRYKGAGVTAAPAKQASKPSGGIVVDGYWGAATTLALQKHFGTPADGVVSSQEVANRGILKACTGGWQWVSHPQGSQLITKMQRALGVPADGIMGKQTVNALERHYGYSADGYLGAPSNTVRKMQQAINAGKF
- Physico‐chemical
properties -
protein length: 279 AA molecular weight: 29806,2 Da isoelectric point: 9,28 hydropathy: -0,34
Representative Protein Details
- Accession
- 6a9a2
- Protein name
- 6a9a2
- Sequence length
- 287 AA
- Molecular weight
- 31297,80080 Da
- Isoelectric point
- 9,53012
- Sequence
-
MWSTTFTKARFGMPSISKAIAVMDKAARVWSLGYDQSNRWDIRNGGECDCSSLVIYALRQAGFATGGATYTGNLSANLTKHGWKRLPPDLSTLQPGDILLNDTHHVCMVVRGHGRNAIIAQASIDERGKASGGRAGDQTGGETNERRVYVYRHGWDCILRYTGAQTEPRPAQPSGKIDVDGYWGPATTRALQRHFGTPIDGVVSSQYAGNRSILNACTGGFEWVRNPQGSQLVTKMQRALGVYADGILGRQTINALERHYGFNADGYLGAPSNTVRKMQEALNAGRF
Other Proteins in cluster: phalp2_24701
| Total (incl. this protein): 161 | Avg length: 266,2 | Avg pI: 8,19 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 6a9a2 | 287 | 9,53012 |
| 1cBKl | 281 | 5,42548 |
| 1cv6R | 281 | 5,82096 |
| 1jBlx | 265 | 8,53009 |
| 1jC1T | 272 | 4,39243 |
| 1jCI0 | 265 | 8,99245 |
| 1kfyH | 265 | 8,97821 |
| 1lUKz | 266 | 9,72146 |
| 1mLVI | 256 | 9,01843 |
| 1nLdn | 266 | 9,38094 |
| 1nQkJ | 266 | 7,59707 |
| 1nWlJ | 264 | 8,94049 |
| 1opZN | 264 | 9,59136 |
| 1oqOA | 264 | 9,70393 |
| 1oqjW | 264 | 9,59136 |
| 21CSs | 275 | 8,55400 |
| 21HR7 | 259 | 6,10203 |
| 23COE | 279 | 9,17496 |
| 23Ejx | 273 | 4,85657 |
| 23Mmc | 281 | 5,81704 |
| 2VazJ | 275 | 8,89343 |
| 2sOe | 264 | 9,35799 |
| 3THXA | 199 | 5,36085 |
| 3TMOx | 286 | 4,59443 |
| 3VI5H | 273 | 4,59591 |
| 3kIbU | 266 | 9,33659 |
| 3kjoT | 266 | 9,13764 |
| 3lDbM | 191 | 9,47455 |
| 3pR2S | 264 | 9,59136 |
| 3pYsv | 268 | 6,44085 |
| 3qoxM | 266 | 9,24949 |
| 3rtRc | 269 | 6,12386 |
| 3uaZF | 264 | 9,31621 |
| 3vMWT | 264 | 9,21390 |
| 3wNlR | 266 | 9,23859 |
| 3wcDv | 266 | 9,27953 |
| 3xHvu | 266 | 7,61190 |
| 41dh4 | 275 | 8,36053 |
| 41gnI | 273 | 4,86061 |
| 4VU5I | 264 | 9,41917 |
| 4Vz68 | 264 | 9,66911 |
| 5C06Y | 269 | 9,28172 |
| 5C1GP | 269 | 6,51224 |
| 5C1PH | 262 | 7,00088 |
| 5C1nI | 263 | 7,72450 |
| 5C2xb | 262 | 6,17620 |
| 5HGOx | 279 | 9,16084 |
| 5HJj5 | 263 | 7,72450 |
| 5HKgt | 262 | 6,02905 |
| 5HLT7 | 262 | 5,64948 |
| 5HOwI | 261 | 8,56187 |
| 5HOy9 | 263 | 6,57976 |
| 5KaN6 | 266 | 9,25175 |
| 5KoSc | 260 | 9,07929 |
| 5Lsiv | 267 | 6,19087 |
| 5OEca | 264 | 9,21390 |
| 5ONAB | 264 | 9,21390 |
| 5QPf1 | 264 | 9,27618 |
| 5RDaS | 254 | 8,86854 |
| 5RpGO | 266 | 9,33659 |
| 5SFWp | 266 | 8,96144 |
| 5SaGH | 245 | 9,00689 |
| 5T4en | 266 | 8,86842 |
| 5T4vn | 266 | 9,55533 |
| 5T9P9 | 264 | 9,25175 |
| 5TGPY | 264 | 9,21390 |
| 5TGZX | 265 | 9,06459 |
| 5UNNw | 264 | 9,35096 |
| 5UYKA | 267 | 6,98372 |
| 5UcPQ | 233 | 8,95397 |
| 5VaGL | 254 | 9,09476 |
| 5XF1O | 266 | 8,70235 |
| 5XGgW | 269 | 5,89525 |
| 5ZaQC | 266 | 9,38100 |
| 5oJL3 | 262 | 6,69071 |
| 5oNO7 | 262 | 6,94825 |
| 5oNOL | 263 | 6,49405 |
| 5oNfw | 260 | 9,05950 |
| 5otH4 | 279 | 9,29868 |
| 5ouAV | 279 | 9,12236 |
| 5ouGD | 279 | 9,26612 |
| 5tEgC | 258 | 8,66592 |
| 5tHAq | 261 | 8,95390 |
| 5tWBM | 270 | 9,17432 |
| 5tX6H | 277 | 9,20475 |
| 5tXI7 | 263 | 8,73290 |
| 5tXIS | 262 | 5,91776 |
| 5tXIz | 262 | 6,02683 |
| 5tXnZ | 262 | 6,99571 |
| 5ubnk | 262 | 5,66386 |
| 618Fs | 252 | 9,19656 |
| 61lbf | 254 | 8,47490 |
| 623hO | 266 | 9,44418 |
| 63Ale | 266 | 9,38062 |
| 642KV | 266 | 9,23247 |
| 65B0s | 262 | 9,21371 |
| 66GbH | 266 | 9,23221 |
| 66RjP | 266 | 9,09476 |
| 67O2y | 254 | 9,09489 |
| 67q6w | 266 | 9,00580 |
| 68CQQ | 252 | 9,07910 |
| 69QQW | 254 | 9,18019 |
| 69yUO | 269 | 6,29727 |
| 6UKc9 | 280 | 5,94004 |
| 6aufP | 264 | 9,62508 |
| 6b0it | 264 | 9,59136 |
| 6eGlf | 266 | 8,86809 |
| 6fAEp | 256 | 8,82542 |
| 6fAdZ | 254 | 8,69371 |
| 6fsDm | 264 | 9,21390 |
| 6fsnN | 273 | 8,73065 |
| 6gcJs | 266 | 9,19617 |
| 6gfwo | 264 | 9,38474 |
| 6h1SZ | 266 | 8,90342 |
| 6iMYh | 262 | 9,38094 |
| 6ja8g | 269 | 6,43863 |
| 6lcaB | 256 | 8,94062 |
| 6nLyf | 264 | 9,42639 |
| 6oBwV | 266 | 9,11082 |
| 6ocHm | 272 | 5,59605 |
| 6prWE | 264 | 9,17902 |
| 6rApJ | 295 | 8,43951 |
| 6rBHO | 268 | 6,16586 |
| 6uW0g | 266 | 9,16439 |
| 6ueLO | 266 | 9,16955 |
| 6v9MR | 256 | 8,94062 |
| 6vNks | 266 | 9,47423 |
| 6vXqo | 266 | 9,23221 |
| 6wCsS | 268 | 5,98045 |
| 6wiCp | 266 | 9,25175 |
| 6wtPF | 264 | 9,21390 |
| 75q1 | 275 | 8,92715 |
| 7BVjV | 264 | 9,56010 |
| 7Y5Dq | 266 | 8,75083 |
| 7Y74H | 264 | 9,19656 |
| 7YLFh | 310 | 4,16484 |
| 7birC | 262 | 9,19856 |
| 7gugU | 266 | 8,95384 |
| 7t9dF | 272 | 6,40987 |
| 80PHc | 264 | 9,31621 |
| 80R4c | 263 | 9,47423 |
| 813p6 | 254 | 7,54585 |
| 85iQl | 265 | 8,91535 |
| 86bDm | 279 | 4,61302 |
| 879Mx | 266 | 9,12668 |
| 88cfp | 266 | 8,91516 |
| 88plx | 275 | 9,43032 |
| 88puk | 262 | 9,24207 |
| 8bLIq | 266 | 9,09483 |
| 8cy2t | 266 | 9,38094 |
| 8cyiv | 281 | 6,42385 |
| 8eN2F | 266 | 9,03197 |
| 8k3T2 | 266 | 8,92766 |
| 8lGva | 291 | 4,35866 |
| 8m8et | 279 | 4,34599 |
| 8mfwn | 266 | 9,29629 |
| 8mjum | 274 | 9,12681 |
| 8n4W9 | 293 | 4,05003 |
| 8s1jN | 277 | 4,45080 |
| fnVr | 327 | 4,66940 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_5920
61YIt
|
56 | 35,3% | 373 | 8.675E-80 |
| 2 |
phalp2_18014
3fSwu
|
12 | 29,2% | 291 | 2.896E-45 |
| 3 |
phalp2_36689
5M39B
|
515 | 36,1% | 246 | 3.491E-44 |
| 4 |
phalp2_36427
10262
|
294 | 35,5% | 267 | 2.365E-34 |
| 5 |
phalp2_36065
6qsuS
|
3 | 33,3% | 210 | 2.091E-31 |
| 6 |
phalp2_8224
7stqi
|
171 | 26,7% | 288 | 7.197E-29 |
| 7 |
phalp2_20113
2363R
|
12 | 25,2% | 336 | 1.544E-27 |
| 8 |
phalp2_32190
6UONu
|
6 | 29,4% | 292 | 2.098E-27 |
| 9 |
phalp2_26836
3VG5h
|
3 | 26,6% | 244 | 2.426E-26 |
| 10 |
phalp2_26512
41oL7
|
16 | 28,3% | 243 | 1.517E-25 |
Domains
Domains
1
287 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(6a9a2)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50