Protein

Protein accession
5oiDm [EnVhog]
Representative
4igQU
Source
EnVhog (cluster: phalp2_3494)
Protein name
5oiDm
Lysin probability
69%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MLFLSAGHYPRAPGAAWQGFVEHTEAQAWVTELARLIPGARVVPTGELGAKVRWINAQASLSDLALEIHFNAGPGNRGQGSESLYSPGSTTGLLAARPIQAILAQFFAPDRGVKPGFYQADKSKGPLYFLKATRCTSLILEPEFIYHAADIRAKRSSCCAALANLLRRTAHDGRVTDLVA
Physico‐chemical
properties
protein length:180 AA
molecular weight:19372,9 Da
isoelectric point:9,33
hydropathy:-0,03
Representative Protein Details
Accession
4igQU
Protein name
4igQU
Sequence length
177 AA
Molecular weight
19522,99040 Da
Isoelectric point
5,87627
Sequence
MIFISAGHYERKQGASFGNFTEWKEATSWQSIIMGLLGPAAIAVPPISLRSKVIFINNHKPDSGDIAVEIHFNSAVNSHGNHIGEGSETLYCPGSSKGKIIAEHVQGSMCRIWPPSRGVKEGWYQMNPDKGPDYFLKATHCPAIIVEPEFVHNEDMIEERRYVGCAALAEALLDLQT
Other Proteins in cluster: phalp2_3494
Total (incl. this protein): 146 Avg length: 184,6 Avg pI: 6,99

Protein ID Length (AA) pI
4igQU 177 5,87627
106b5 173 6,69986
14jAj 183 6,07014
16VNX 196 5,81681
16Wf4 170 5,95766
18RKd 201 8,28620
18Rza 193 6,05957
1aplT 194 5,88434
1bb9U 178 7,05698
1dCLq 178 7,05624
1hHCv 192 5,14054
1hLHW 192 5,49573
1i9L1 183 5,62345
1iQjA 191 6,42215
1j6g9 205 7,66021
1j6jJ 165 4,92035
1oPy8 202 5,51841
1oyU5 184 6,06327
25cfW 193 7,68545
2D5le 191 6,54020
2DhWg 180 7,10103
2IJkx 189 6,23861
2R1EJ 190 6,05644
2TCVV 187 6,08134
2V8Z4 174 8,80395
2V9c8 175 6,38179
2abfG 200 5,46293
2agWD 191 6,28886
2dNqz 181 5,86751
2jY7E 173 5,95408
2jsHy 207 5,76537
2lMut 176 5,09928
2lOqj 196 5,29503
2ltIL 205 4,93621
2ltxn 201 5,32879
2m6iX 196 5,28724
2rG3m 176 5,39950
2rGzV 187 4,66031
2rRjK 174 4,72692
2sFey 188 7,72183
33nIH 170 9,71753
343oZ 170 9,54882
38xtN 225 6,12505
3HBG 191 4,89261
3QwGb 212 5,66175
3bt3U 188 7,73035
3grqI 192 8,80704
3yTxb 231 6,24936
41Fap 169 9,15898
43MpK 179 8,45801
44Y8f 189 6,08219
44aZ 176 6,04746
47OUc 198 6,59335
47PtJ 191 7,72728
47SQn 192 6,65490
48m56 178 8,76984
4BDjw 183 6,09254
4BUaU 180 9,12197
4BXBy 180 9,50588
4BYyv 179 9,24169
4C0Eu 180 9,40292
4C1c6 168 9,27334
4C4vQ 172 8,88950
4K9Fm 145 6,18308
4Nagm 196 6,11789
4NbSY 191 7,68068
4NgQS 192 5,78117
4Ngb5 187 6,19814
4Okjs 178 6,69878
4QlQC 191 5,34385
4Qlxw 190 6,08583
4QrMM 202 6,64865
4e0qt 174 8,22393
4hC37 182 5,73826
4hFvY 188 5,85074
4hJtQ 178 5,52034
4hK6k 216 5,42195
4hKsE 177 5,28747
4hNcO 187 4,90170
4hq01 179 5,51630
4hrC3 185 4,96059
4hwC8 191 5,63760
4iFwG 188 5,59832
4iL8j 189 6,14841
4iXLM 192 5,26104
4iYXH 193 4,89824
4iZMu 177 4,71311
4iZiA 198 5,21068
4ianV 196 5,76429
4ijUP 188 4,77433
4j15A 190 5,41814
4jA72 178 6,05559
4jGYs 191 5,39961
4jGba 176 5,57167
4kAcS 144 5,94191
4kzbL 167 6,07208
4lL3R 170 9,90417
4mCBl 180 9,36360
4nGAi 171 9,79721
4oXcP 180 9,40395
4peOl 168 9,58402
4rH4S 180 9,54862
4rVqG 168 9,50556
4s2Xk 180 9,40292
50YwC 170 8,92889
51bOu 180 9,29803
58eB0 180 9,36366
5B93T 213 5,80698
5Hgn5 186 8,88531
5d5g5 170 8,95693
5dMQQ 180 5,97113
5grgf 162 8,67907
5hLu2 170 9,90010
5ib0K 170 8,94539
5ij6U 180 9,12474
5qTlI 200 6,12994
5uX4b 170 9,55926
5veT7 170 9,36456
5vgSR 170 9,92434
5w3xo 171 9,87090
5wC2n 170 9,56184
5zsSg 180 9,54811
6LYns 180 9,36366
6Q6FL 170 7,83750
77WNx 194 6,02609
7IxSJ 190 7,72166
7kPJ4 191 5,28645
8e6cL 190 6,24111
A5Zp 199 4,64820
Jo8q 170 9,90642
LETJ 168 9,41285
QGgj 180 6,12266
Qr2l 185 7,07903
TkIa 170 9,25162
UMoA 205 6,21952
VQYU 237 5,43633
VRO5 204 5,81283
XMml 185 5,26314
XNMH 192 7,75286
Yg9h 182 6,15529
cbxq 198 8,89814
f0PK 179 7,05397
l37C 183 5,57508
otrL 180 5,96459
uHgI 180 9,14988
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_32886
3hE4J
1 42,2% 187 6.413E-64
2 phalp2_29375
16Xou
2 32,7% 180 1.246E-47
3 phalp2_39240
3QaAt
19 32,2% 177 1.061E-39
4 phalp2_1736
2tF5N
2 31,6% 161 5.170E-27
5 phalp2_38396
Ydyo
10 35,6% 160 1.623E-25
6 phalp2_21852
4t88M
271 29,8% 181 1.776E-23
7 phalp2_6374
7yZe6
41 27,6% 181 4.050E-22
8 phalp2_1943
4rYA7
14 27,9% 168 7.566E-22
9 phalp2_36343
kBxJ
714 29,0% 196 1.034E-21
10 phalp2_21590
2ns10
22 28,8% 187 6.735E-21

Domains

Domains
Representative sequence (used for alignment): 4igQU (177 AA)
Member sequence: 5oiDm (180 AA)
1 177 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01520

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4igQU) rather than this protein.
PDB ID
4igQU
Method AlphaFoldv2
Resolution 97.83
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50