Protein

Protein accession
5meoz [EnVhog]
Representative
1Qasw
Source
EnVhog (cluster: phalp2_20092)
Protein name
5meoz
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MSIQIRDVIKYYKGLPNQDKALAELQKLLDSNKLADDSASWVQLWRISPPAAPAKTFSNTWDGIEAAAAAAGAKFPEVVAAQWALESAYGTAISGKNNFFGIKGTPGTVKTTWEDYGNGPVTIQATFKDFATPYDCVNHLVTQWYKDYKGYKGVNRAANREDCAYLLKREGYATDPIYPQKLIKLMKDHD
Physico‐chemical
properties
protein length:190 AA
molecular weight:21105,6 Da
isoelectric point:8,37
hydropathy:-0,45
Representative Protein Details
Accession
1Qasw
Protein name
1Qasw
Sequence length
197 AA
Molecular weight
22604,33920 Da
Isoelectric point
9,06401
Sequence
MTIHDGLITPQKWRDCWRWFRGENHQQEAINLLYEHIKATDPALLHQSAEWLQLFTAKQLAEHEYPNSWEGVKAAAAAYGARFPQVVAAQWALESNYGAYPSGRWNMFGLKGPGTPKKTQEVYDGKAVQITASFMDFTSLGHAVRYLCDRWYKDYKGFRGVNRATSAEECARLLQSEGYATDPLYSKKLITILRRRP
Other Proteins in cluster: phalp2_20092
Total (incl. this protein): 159 Avg length: 188,6 Avg pI: 7,49

Protein ID Length (AA) pI
1Qasw 197 9,06401
13LgE 193 8,34197
155pU 205 8,88447
156z6 375 7,64794
15cYR 188 6,83451
15d19 188 6,43596
15dpH 189 7,66647
15m2j 187 7,67198
165aA 193 8,76533
165g1 189 5,96107
16SyR 189 6,15245
16oBf 189 6,73738
16pEs 187 9,17812
16pdU 189 5,96113
1F1YA 189 6,90721
1NwZh 184 8,38226
1Phjm 197 8,62466
1TaTr 209 4,72744
1YK4 189 9,44721
1ebtS 187 6,74374
1pEYE 187 7,68670
1wYI 184 6,59835
22cFL 189 5,01339
24hVM 189 7,62412
24t1V 184 9,28424
26WEK 189 5,95521
273cd 189 5,60384
27WVq 187 6,84025
27nwv 133 6,73124
29AFD 177 6,48558
29Hcu 189 6,83423
29Pux 191 6,10931
29R2Y 191 6,83440
29TE0 187 7,70176
29VxM 187 7,71182
2IDhN 187 7,69750
2Ihcf 187 7,70665
2IpbU 187 7,67562
2IuOz 187 7,70176
2J9mf 187 6,83792
2JJlW 188 6,83855
2K87W 189 6,73567
2Kzxk 191 6,31739
2M1Kx 189 6,82707
2N4O 168 6,49047
2OWP7 196 7,70051
2PMWJ 188 8,61647
2Pu4E 191 6,83554
2Qnne 187 7,70597
2Uujd 190 7,67010
2WAoG 203 8,34397
2XhMj 195 5,85711
2ZQ9g 193 8,87390
2a5Tc 188 5,95845
2s5XC 209 4,65406
2uSjW 184 7,66374
31FTM 150 5,45560
32a48 188 7,69153
33vGT 193 9,02050
3YsQC 375 8,13780
3Z7c7 189 6,73624
3ZjCt 215 5,40132
3jy4c 184 9,28424
46OyJ 136 8,96912
46Qb6 193 9,02050
46S0s 194 9,28572
46m7y 193 9,00702
47Jo3 137 9,18521
48HS4 136 8,95390
48i6E 192 9,24962
49fRx 189 9,33530
4BUp8 187 8,38419
4CeVB 190 8,37233
4DEFH 188 7,66988
4NZVQ 188 7,69653
4O3ES 188 7,66453
4O3L7 192 9,30035
4XYfq 191 9,14898
4Xc5S 189 6,61580
4ZXtB 190 8,68126
4lg7r 188 7,71734
4mN7I 135 7,98668
4sChP 193 8,39432
4sJLh 188 6,83809
4sMbS 182 6,37673
4sO36 188 6,83690
4sRZX 150 7,90352
4sTMz 187 5,83301
4sgmr 186 6,43528
4ts49 189 6,90050
4wkE7 188 7,69653
4x4X6 184 7,66243
4x4pc 187 5,56018
4zSPL 192 9,28585
52OaQ 125 9,44238
55ZN9 197 8,61241
564bp 376 8,11433
59SZP 131 9,03984
5ADtj 189 8,39438
5AEeh 192 9,31538
5BXLv 193 8,97827
5DzNi 98 9,33530
5Hv41 194 9,31596
5aUfB 187 8,40154
5aUrq 190 8,37233
5aWJm 188 6,16830
5cPPL 113 9,69535
5d4Aa 137 7,85575
5hk4d 192 9,21938
5iVoE 188 7,65936
5jFtE 188 8,39264
5lgzD 241 5,17300
5lsIw 197 8,62253
5mmKX 196 6,31165
5tbMo 189 6,73937
5tbyz 189 6,16313
5uyk9 125 9,44238
5zq2l 188 7,69193
6CXmK 184 6,59579
6IB2w 195 5,97187
6IKRg 136 8,74180
6IviY 188 6,60449
6Iw8u 136 9,11365
6IwMk 187 6,83934
6Kd3m 192 6,31631
6L7pn 187 7,71228
6LCgi 199 5,45469
6LmcF 145 6,79467
6Lr0W 187 6,83230
6MELw 145 6,79552
6MHKM 189 5,95828
6MfNn 188 7,66453
6MuGO 188 7,73104
6MxbA 187 8,38419
6PcpV 190 4,88158
6SS7E 264 8,83747
6TrsA 291 7,60235
6U0gd 188 6,60449
6zUNv 147 7,84472
6zns6 249 8,71169
7EVQe 189 9,44721
81wbI 190 5,01339
81xMh 189 5,58440
88eCf 187 6,73749
8DJen 188 5,80874
8F1ht 187 5,52864
8a9gX 187 6,60102
8rbru 187 7,72467
AezR 181 8,71659
AgFk 187 7,69642
BsH 188 8,39599
Dnm1 191 6,31722
PFXd 190 8,90903
dRyp 198 5,51670
jWzn 189 5,95828
s835 184 6,59579
tdcM 189 8,37246
yMYb 182 5,38546
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_22042
5ukhE
104 55,5% 126 8.429E-74
2 phalp2_40632
7SWvA
1 41,2% 126 3.121E-30
3 phalp2_37
7CjdH
2 25,8% 143 1.182E-17
4 phalp2_1473
1PLYJ
2 38,2% 141 7.547E-17
5 phalp2_14516
4U1py
1 29,4% 129 1.630E-11
6 phalp2_23271
4Y2T6
95 30,2% 142 1.743E-08
7 phalp2_37455
2SP4P
199 25,4% 153 4.301E-08
8 phalp2_34390
4fPRh
1 25,7% 175 1.568E-06
9 phalp2_22607
1LayP
7 24,8% 161 3.066E-05
10 phalp2_39408
4T0un
2 25,1% 139 1.344E-04

Domains

Domains
Unannotated
GLUCO
Representative sequence (used for alignment): 1Qasw (197 AA)
Member sequence: 5meoz (190 AA)
1 197 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01832

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1Qasw) rather than this protein.
PDB ID
1Qasw
Method AlphaFoldv2
Resolution 91.09
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50