Protein
- Protein accession
- 5kuCb [EnVhog]
- Representative
- 1LNa3
- Source
- EnVhog (cluster: phalp2_25165)
- Protein name
- 5kuCb
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
LTAYPDPLTGGLPITIGWGSTRKRNGQPFHLKETITQEEANDLLIFDIESKFLPALQKIPYWDEMNDNQRGALLSFAYNLGANFYGSRGFNTITTNLKQKNWKAIPETLKLYRNPGSNVEVGLLRRRGAEGKLWSS
- Physico‐chemical
properties -
protein length: 136 AA molecular weight: 15372,3 Da isoelectric point: 9,43 hydropathy: -0,55
Representative Protein Details
- Accession
- 1LNa3
- Protein name
- 1LNa3
- Sequence length
- 72 AA
- Molecular weight
- 8172,23240 Da
- Isoelectric point
- 9,81829
- Sequence
-
MTDNQKGALLSFAYNLGAGFYGSSDFNTITRVLKNKEWVKVPDALYLYRNPGSNVELGLSRRRMAEGNLWKK
Other Proteins in cluster: phalp2_25165
| Total (incl. this protein): 124 | Avg length: 86,5 | Avg pI: 9,59 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1LNa3 | 72 | 9,81829 |
| 1597o | 76 | 9,57125 |
| 15bPY | 79 | 9,62747 |
| 15ee0 | 106 | 9,58711 |
| 15kZ4 | 75 | 9,57009 |
| 15nWc | 79 | 9,52090 |
| 1601e | 77 | 9,57131 |
| 162Sn | 62 | 9,52084 |
| 163il | 106 | 9,07168 |
| 164Bs | 79 | 9,62747 |
| 16o5O | 72 | 9,84073 |
| 16ocj | 79 | 10,22625 |
| 19Eqk | 83 | 9,92976 |
| 1PLK9 | 84 | 9,85220 |
| 1PQcL | 99 | 9,10276 |
| 1aqAp | 72 | 9,75144 |
| 1armE | 57 | 9,89624 |
| 1ikJG | 55 | 9,22802 |
| 1wUIr | 95 | 9,51961 |
| 1zDlr | 60 | 9,69613 |
| 26SRe | 85 | 9,81655 |
| 27Hdc | 70 | 9,91364 |
| 27Sje | 92 | 9,51626 |
| 27wKT | 60 | 9,99223 |
| 29Pfz | 90 | 9,80920 |
| 2IlqN | 73 | 10,97486 |
| 2KGTz | 72 | 9,98372 |
| 2ixlQ | 72 | 10,08313 |
| 329RK | 95 | 9,51961 |
| 32c87 | 113 | 9,36315 |
| 3PkFn | 84 | 9,84730 |
| 3UxGh | 81 | 9,84730 |
| 3XFB6 | 78 | 9,58086 |
| 3cXOx | 102 | 9,26167 |
| 46Bak | 153 | 9,38365 |
| 46Pfu | 74 | 9,39738 |
| 475BF | 80 | 10,20330 |
| 48h8x | 73 | 10,07642 |
| 49xim | 72 | 10,26100 |
| 4AcKH | 72 | 9,86439 |
| 4BZoF | 64 | 9,66583 |
| 4ClOm | 108 | 9,47339 |
| 4DKkP | 73 | 9,81713 |
| 4DVcR | 94 | 10,32998 |
| 4YA3c | 72 | 9,80127 |
| 4Yzdv | 72 | 9,98772 |
| 4ml6F | 88 | 10,13258 |
| 4nzYP | 136 | 8,16262 |
| 4oMtN | 73 | 9,91326 |
| 4qf0S | 72 | 10,14199 |
| 4qqvC | 53 | 10,59108 |
| 4vLJZ | 73 | 10,25584 |
| 50RqN | 99 | 9,30093 |
| 50X4z | 103 | 9,47551 |
| 52GZa | 73 | 10,07642 |
| 52MoL | 107 | 7,82267 |
| 54SOY | 136 | 9,79850 |
| 54l6L | 64 | 9,62914 |
| 551aS | 103 | 9,64397 |
| 55Vem | 95 | 9,92351 |
| 565cY | 73 | 9,75150 |
| 57hSc | 95 | 9,52032 |
| 592tN | 108 | 9,47339 |
| 5ANpe | 94 | 9,91248 |
| 5ByhY | 108 | 9,56577 |
| 5Cubt | 64 | 9,62914 |
| 5Dcc6 | 118 | 9,43290 |
| 5Iakk | 72 | 10,59088 |
| 5ac3v | 95 | 9,69361 |
| 5c5qT | 106 | 9,34335 |
| 5dabL | 72 | 9,66408 |
| 5f78D | 53 | 10,59108 |
| 5hncP | 95 | 9,64410 |
| 5hwNM | 122 | 9,55139 |
| 5iJsd | 95 | 9,84524 |
| 5kqmP | 103 | 9,33588 |
| 5lpZd | 149 | 9,05757 |
| 5luCe | 73 | 9,99010 |
| 5mlv4 | 136 | 9,25942 |
| 5uTnW | 72 | 9,98378 |
| 5uYCs | 73 | 9,81707 |
| 6GMm8 | 107 | 8,08951 |
| 6GdTN | 72 | 9,24826 |
| 6L2y1 | 72 | 9,80127 |
| 6L3EJ | 72 | 9,80263 |
| 6LPWC | 73 | 9,84885 |
| 6Llwk | 106 | 9,74873 |
| 6MFq1 | 73 | 9,91326 |
| 6MHBG | 107 | 7,82467 |
| 6MLfa | 149 | 9,05782 |
| 6McAe | 106 | 10,05212 |
| 6Mx8G | 64 | 9,69406 |
| 6UALG | 63 | 9,62805 |
| 6X3tr | 104 | 7,91648 |
| 6ztge | 136 | 9,56841 |
| 7JX4A | 72 | 9,51452 |
| 7L7hY | 95 | 9,51839 |
| 7Qnbw | 114 | 6,73613 |
| 7nY0u | 90 | 8,00718 |
| 8I3Dt | 72 | 9,59452 |
| 8jFZn | 78 | 9,91454 |
| 8rCW7 | 72 | 10,20388 |
| AT2T | 72 | 9,84073 |
| C8uO | 136 | 9,69593 |
| FOz6 | 107 | 5,02692 |
| Fg16 | 94 | 9,05595 |
| GGsl | 72 | 9,62811 |
| GJEi | 72 | 9,99171 |
| Gob9 | 72 | 10,35222 |
| Gpi5 | 77 | 9,62837 |
| IKBh | 72 | 9,51458 |
| INBW | 100 | 9,39738 |
| Jhdk | 67 | 9,62914 |
| Kpiv | 67 | 9,62914 |
| L5Ni | 77 | 9,57131 |
| LTTN | 67 | 9,62914 |
| bSOG | 73 | 9,98681 |
| bXGz | 74 | 9,57628 |
| h2JN | 78 | 9,58086 |
| heg5 | 79 | 9,57131 |
| iyhY | 106 | 10,13258 |
| jQNb | 69 | 9,99049 |
| A0A7D5JWD6 | 72 | 9,59452 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_13104
8kSiJ
|
1 | 34,2% | 70 | 3.345E-06 |
| 2 |
phalp2_9510
12ud4
|
2 | 39,3% | 66 | 4.602E-06 |
| 3 |
phalp2_7764
77796
|
37 | 36,1% | 72 | 6.333E-06 |
| 4 |
phalp2_37101
1bvx6
|
877 | 38,5% | 70 | 1.543E-04 |
| 5 |
phalp2_15074
7BwGK
|
4 | 34,8% | 66 | 2.124E-04 |
| 6 |
phalp2_24173
2nDwl
|
15 | 34,7% | 69 | 4.023E-04 |
| 7 |
phalp2_39267
4724r
|
247 | 34,7% | 72 | 4.023E-04 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1LNa3)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50