Protein

Protein accession
5hY38 [EnVhog]
Representative
400dW
Source
EnVhog (cluster: phalp2_24363)
Protein name
5hY38
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKKGIDVSEHQGIIDWKKVKDDGIEFAILRVGYAVTLDKQFLNNVKGCQDNNIPFGVYLFSYATDVNEAVAEAKFVLEKIKDFEVEYPVIFDYEYDSVRYFEKINKSKPSNELINQMASAFLLEIEKAGYYAMNYMNKDYYNHVFNDYIKTTFDNWIAVWGVGEAFTTPNLWQYSSTGKVNGINGNVDMNYCYRDYPELIKSMGLNKLKGNDWDSMYKELDKSYQQFIHDLEVLIDLYK
Physico‐chemical
properties
protein length:239 AA
molecular weight:27946,3 Da
isoelectric point:4,86
hydropathy:-0,43
Representative Protein Details
Accession
400dW
Protein name
400dW
Sequence length
262 AA
Molecular weight
30849,18190 Da
Isoelectric point
8,49044
Sequence
MDKRFKRNVEGLIKTGIPFGIYYYSYALNENEAKKEADSILYIIKDYKDYISYPVAIDMEDSDKYKKNAGFPDNKALCNICKTACDIIGNAGYYPIIYANLDYFTHYLTEDSISKYNKWLAWWDKEAINKIDKKKYQMLQYSSIGKVEGVGTNVDLNESFIEYNKLIAYLNNIKKIQEIKLKTGIQDLTIQYMSCYKFGNFLIDKIYKRINAKKLPKDTKDDIHKVVQKEYGLEDKTVVFLENFIYSEHLFLKLYRAICEEK
Other Proteins in cluster: phalp2_24363
Total (incl. this protein): 200 Avg length: 275,2 Avg pI: 7,45

Protein ID Length (AA) pI
400dW 262 8,49044
14iZv 298 8,93185
19eNa 340 5,44622
1FJN5 352 9,47597
1dR5q 266 9,19650
1eqDN 286 5,68301
1gBMz 239 6,47700
1gBw7 197 8,84192
1gELB 295 8,99593
1gJQ3 294 8,64419
1jGyM 265 8,98111
1k7NN 265 9,23273
1kcCq 265 9,21210
1kfpY 272 9,14698
1m5ek 265 5,43730
1n0HH 258 4,82190
1qwa2 287 4,47831
1zJ3a 275 4,36554
20BAY 261 5,05704
20C49 262 4,94109
20DyE 260 5,41553
21CB2 278 5,80289
21Dkr 270 8,42474
236l7 335 8,96634
23CK0 278 4,88306
23v7g 340 6,84293
23xav 340 5,85188
2FCZM 296 9,15008
2MA07 263 8,85778
2Q312 280 8,50082
2m3zG 336 8,74554
2msY0 283 5,04602
3bYdY 244 8,82561
3dOFn 260 8,86216
3dP2A 310 6,09583
3dRxL 256 4,64928
3dZGc 246 8,36324
3gLNn 258 4,62450
3gX6v 283 7,62225
3gjwL 262 5,53171
3h0iP 310 6,08208
3iBjq 279 8,27640
3l6K7 336 9,27637
3nt3Y 277 4,34042
3o4bT 257 8,47258
3qeop 336 8,89794
3rWQe 337 9,24575
3sQIM 336 9,21371
3tfqL 336 9,40447
3w3yL 266 9,20172
3x4TV 284 6,52787
3yWLy 281 5,85410
40XJt 303 6,08128
40aSP 290 4,73500
4AY 292 9,52812
4USpR 290 9,32118
4kh2Z 272 5,43690
4kksd 320 8,04399
4kkwo 291 4,65434
4xEbw 265 5,70529
4yy6q 338 8,71988
5Apa 251 9,18476
5JX2q 211 5,87507
5KEnr 335 8,75308
5LDF9 209 5,29173
5MMlA 207 6,72300
5N4x4 336 9,19443
5NH3E 246 6,36428
5NRol 268 9,08084
5NYPO 249 6,44591
5OhVT 266 9,22776
5OsH3 209 5,29168
5QefJ 336 9,01115
5Qt2b 339 9,11520
5RNbF 336 8,84617
5RvCp 207 6,70265
5S8SD 266 9,18844
5T8XR 336 9,24465
5TpmQ 280 5,63373
5U4df 266 9,29952
5V2Zt 210 6,12334
5VYZc 274 6,00643
5Vcq0 274 6,00643
5WUdA 342 5,27218
5WVzB 211 5,87865
5ZmhR 258 6,72379
5irkK 239 4,98708
5xHP 333 8,75347
60U4e 336 9,01115
61D6r 210 6,12215
61k5x 206 6,32404
622Rc 244 8,93475
62OSc 301 9,23950
62bf6 266 9,22763
63blc 266 9,22834
648pi 336 9,41253
64Dg0 337 9,18354
64YQW 270 9,18508
64tFt 336 9,27753
65Fe4 284 7,60224
65GP5 208 6,34217
65QIi 265 9,19650
67PF0 336 9,34503
682CJ 249 5,69501
68eVY 266 8,93920
6QbXR 334 7,49777
6UIjY 271 6,02785
6a1Pv 209 5,57985
6asR0 275 4,62899
6bUKk 209 5,29173
6bozI 341 8,40650
6cKoo 211 6,13608
6cMDU 209 5,38228
6dx6n 209 5,17845
6eobk 337 9,34361
6fSap 265 9,24659
6gcVy 336 9,37185
6hQkb 211 5,87507
6hiPB 206 6,32410
6hnp2 342 9,31447
6i2kg 265 9,20539
6k4lJ 219 5,43571
6k71C 208 6,59852
6kow8 336 9,32930
6l0wx 209 5,29173
6lZKi 266 9,16278
6lmfP 244 9,09760
6lwY2 266 9,04184
6m8Rv 336 9,28482
6mSxr 207 6,70265
6mUng 336 9,29223
6mczQ 371 9,57873
6mzOD 206 7,62503
6n8ck 266 8,94823
6nBVa 266 8,98556
6nlDN 208 5,98721
6nuwn 266 9,11411
6pXyL 336 8,88305
6q1j1 266 9,23195
6q6lF 280 7,59644
6qmGW 337 9,27631
6r78f 207 6,81922
6rBcZ 337 9,30003
6rI1X 246 8,02794
6rRGt 337 9,18328
6rS5G 335 8,75972
6rfki 270 8,40244
6sbr1 243 9,18889
6siVz 277 4,77348
6tv3q 253 6,08265
6u7zp 336 9,23060
6uGch 192 8,87332
6vQ3u 336 9,19443
6vYfY 266 9,23279
6vnnB 266 9,16974
6vq0l 210 6,52974
722Dv 274 6,63359
73O9z 322 6,60488
7XWBZ 208 6,11988
7XuKd 206 6,83036
7YxhI 228 6,21287
7YxnF 284 7,57189
7bfT7 285 9,30912
7eg9h 322 6,73095
7wMlP 302 9,08767
7y6UL 329 5,51784
80OZV 336 9,16968
80hRG 209 5,41320
82GFg 277 8,76011
83wJP 208 5,98341
83x6P 336 9,31467
85aFV 209 5,43991
88bvq 266 9,07981
8bLFc 266 9,23692
8bfvE 241 9,18960
8dcS9 208 5,98466
8dnCM 272 9,11926
8eUg7 335 9,01334
8f8k5 208 5,63891
8fKqc 209 5,29173
8lNcE 210 5,43991
8lXVj 288 4,95064
8lkdY 208 5,85955
8lynm 206 6,32404
8qm65 209 5,29173
8r46R 275 4,81201
8r5X0 275 4,52321
8shwq 270 6,60449
8v6x0 208 6,11505
CSys 342 9,01115
R9mu 348 9,39229
a5wH 258 6,61023
kBt9 244 8,10750
nb7h 296 5,32214
nelB 296 5,32214
ngtl 296 5,82761
ogVn 296 5,61060
oi34 337 8,68797
yn9N 341 8,75398
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_3425
3TK4D
923 35,7% 176 5.208E-58
2 phalp2_6199
5X5xO
102 41,4% 176 4.671E-57
3 phalp2_27173
3dR30
17 33,4% 212 8.868E-46
4 phalp2_24407
4kkNT
14 31,7% 252 2.169E-42
5 phalp2_31512
3WNwM
280 31,1% 183 5.526E-42
6 phalp2_13529
7Jyqc
660 32,3% 167 6.689E-41
7 phalp2_24174
2ojoF
57 33,3% 171 1.247E-40
8 phalp2_29898
8dgkX
166 30,0% 206 1.247E-40
9 phalp2_11208
6hYV2
1315 30,1% 169 9.758E-39
10 phalp2_4911
6bcJV
40 29,6% 189 1.309E-33

Domains

Domains
Representative sequence (used for alignment): 400dW (262 AA)
Member sequence: 5hY38 (239 AA)
1 262 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01183

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (400dW) rather than this protein.
PDB ID
400dW
Method AlphaFoldv2
Resolution 84.42
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50