Protein

Protein accession
5hQpB [EnVhog]
Representative
7cyBj
Source
EnVhog (cluster: phalp2_2703)
Protein name
5hQpB
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MEEHMGVNDGHTISGAGSGAVGFINESMETRKVGKFVRQMLSELGYKVSNCTVDYANSSNEALNLIVNLANNKDLTFFISIHFNASGGRGVEVYTYEGRQFEDAVNVCRNISNLGFINRGVKSGTGLYVIRKTKAKSMLIEVCFVDSADAQHYLKVGAYAIAKAIVEGITGKKVVEKIKFPMPLKMKYDCPAVRINGTSIELIKYFYKNDNITASGELEDKYLLNINGVNGYVYKSATTNR
Physico‐chemical
properties
protein length:241 AA
molecular weight:26546,1 Da
isoelectric point:8,87
hydropathy:-0,16
Representative Protein Details
Accession
7cyBj
Protein name
7cyBj
Sequence length
291 AA
Molecular weight
31710,30300 Da
Isoelectric point
6,88999
Sequence
MKINLDMGHTVSGADTGAVGCGRKEQDCTREKGYKVKEKLEALGHSVCICSVDSAETVNESLSARVNKANANGGDLYVSIHLNAGGGYGTEVYTYQGKELSEARNVLNNICNLGYRNRGIKGANLYVINHTKMPAMLIECCFIDSNDDMRRYNAEDIANAIVKGLVGEASNSTANIKVNESNSKPSSDWVRRLQEECNRQGFSNQVVDGIPGPNTLEGCPTLRYGARGNITKLLQERLVELGYDINLVDGIFGENTKWSISLYQENNGLIKDGIVGKGTWSKLGVGNYKQK
Other Proteins in cluster: phalp2_2703
Total (incl. this protein): 192 Avg length: 275,5 Avg pI: 8,61

Protein ID Length (AA) pI
7cyBj 291 6,88999
13vJn 255 9,49975
13vyh 290 9,29977
140U 255 9,24936
1EmAc 241 8,48025
1FVEz 321 8,96873
1HsT9 257 9,49975
1KtWQ 371 4,71425
1bXhW 252 9,06982
1ceEy 248 7,67601
1cmxl 253 8,94133
1m2tg 297 8,76482
1mJ9W 281 9,17245
1n3qi 295 8,48786
2Vxmh 276 5,94743
2lswb 261 9,24459
2musf 281 9,23350
2nenO 315 6,65223
3bSTx 256 9,41227
3bUmX 281 9,25400
3kICo 321 9,13022
3lFNW 314 9,11894
3lgpO 295 7,61099
3q7Z7 297 8,97376
3sRH3 297 8,76482
3xWxt 292 6,24367
4UzXZ 253 9,20372
4ZFp0 292 6,91204
4xEd6 278 8,10260
57649 295 7,05346
5KSaW 321 8,93417
5KUoE 297 8,98246
5L6qy 348 8,85559
5LNeR 346 4,84430
5MEEW 295 8,44009
5OlzL 324 8,80330
5Pkll 269 8,86816
5QcU2 324 8,81749
5R92y 264 9,19334
5REHd 261 9,17374
5Rz5T 301 9,55604
5Tka3 295 8,19421
5U0FN 261 8,94275
5UfL1 240 9,31267
5Xw9W 264 9,15756
5Zf96 295 6,44897
5ZtZp 297 9,07716
5hRpg 291 6,92637
5hSff 291 7,47975
60XeZ 324 8,67778
615pO 264 9,25465
62mao 244 6,89630
63Wvm 301 9,66757
63iCc 265 9,26812
64gtq 298 8,61112
656Hc 292 6,96007
65bFd 261 9,36121
67Ck1 284 6,90016
68WLB 301 9,39609
68a1J 263 9,39641
68t3l 381 7,87509
6M2lq 264 8,75818
6WzPs 311 5,61026
6a9a4 298 8,76482
6cRV6 264 8,65928
6ddk8 295 8,18557
6hn9r 269 9,05170
6iEYK 302 9,12294
6icsn 295 8,93591
6jpEB 281 9,26483
6kN7R 294 9,21422
6kQD8 295 7,61099
6mKxm 283 6,21241
6mdAA 297 8,17970
6mvMD 297 8,59778
6nQpu 291 6,54111
6odpU 261 9,22493
6ovlm 297 8,87506
6pfWx 221 8,81807
6tjAJ 264 9,07968
6x3A 321 8,87525
72kO6 270 8,83438
72zwQ 346 5,01828
76SaX 253 8,98446
77oG5 256 9,37707
782PP 253 8,85378
78PI7 294 9,36695
78iDv 363 8,67172
797V2 256 9,36321
79F7w 296 8,67018
79KhH 282 6,23918
7Bcl3 253 8,93437
7Bclp 253 9,09696
7BdJu 256 9,31325
7Bkgf 252 9,12197
7Bkmu 257 9,44882
7BknC 255 9,27386
7BmqR 257 9,39171
7Bmt8 257 9,37726
7BrS4 256 9,35244
7Byaz 252 9,13048
7BydP 253 9,02694
7ByhA 250 9,13951
7ByiD 253 9,09702
7Z7yo 324 8,53266
7cfQq 252 9,02688
7ctok 295 7,61099
7ctqF 290 8,94404
7d0JO 306 8,78196
7d0KU 297 7,62838
7d2VO 278 6,83412
7dYNE 284 5,96283
7deGk 256 9,36321
7dkQf 294 6,94711
7dpDC 256 9,46372
7e6Ao 254 9,48493
7eMy6 253 8,93437
7eUDU 253 9,13963
7fA1p 255 9,24639
7fSks 223 8,57773
7fnPA 250 8,71189
7gGvE 255 9,39171
7gHKb 253 9,00038
7gIqQ 253 8,85339
7gYfZ 255 9,46391
7gYfg 253 9,18392
7hklV 256 9,37707
7htMG 251 8,93430
7iYj9 301 6,63825
7iYmS 252 9,02694
7iYnX 259 9,28649
7iYp5 259 8,68642
7iYto 256 9,37101
7iYuF 256 9,18302
7kJJJ 271 9,28662
7kJMU 256 9,36701
7kJNZ 254 8,95590
7kjX1 257 9,39809
7kk82 256 9,36321
7kk9e 252 8,84063
7kkda 257 9,31325
7kknC 256 9,47977
7kzhJ 256 9,31305
7l0ip 214 9,03597
7l0iy 255 9,28649
7lCY3 259 9,38449
7lCZk 255 8,19421
7lluv 259 8,95364
7lncP 256 9,46372
7lnlB 253 9,13938
7lnsk 256 9,08065
7lnzI 256 9,28649
7lzOl 281 9,29997
7piPK 327 8,54511
7pwFO 292 8,87235
7pwIe 297 7,59860
7tiko 253 8,99297
7u27f 253 9,05634
7u2aQ 261 8,84385
7u2cq 251 9,07884
7u2dv 257 9,41988
7uLOd 252 9,02578
7uZjb 253 8,66444
7uy79 281 9,16317
7uyg8 252 8,61602
7uyhp 255 9,13048
7uykk 252 8,80130
7vPZ8 260 8,63594
7vdDC 256 9,21448
7vdEN 252 8,74083
7vdG5 253 9,34174
7vdK6 253 8,97659
7vdMS 256 9,31312
7vdtu 258 9,31312
7vdv3 256 9,40647
7vdwZ 257 9,35264
7vr7I 252 8,85378
80r0d 376 9,12693
81iJ 286 8,38078
82rOH 291 8,48799
85muo 293 6,13534
88p7X 345 6,99332
8fKwa 298 8,76482
8fsRs 256 8,92534
8miDM 263 4,87601
8n07p 310 8,62608
8nYyB 290 8,82587
8s7k1 297 8,87506
lCLi 299 8,80234
wzP9 321 8,97627
A0A2H4JDW4 152 6,40998
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_10532
82sT5
257 39,1% 350 1.008E-91
2 phalp2_36719
6eCmw
993 45,8% 194 1.374E-70
3 phalp2_23331
5tGuH
43 40,2% 194 1.977E-51
4 phalp2_26225
oqMn
4 32,2% 335 2.701E-51
5 phalp2_263
6tFdA
76 32,4% 317 5.041E-51
6 phalp2_6374
7yZe6
41 40,3% 181 6.110E-50
7 phalp2_7597
5EJWp
11 30,6% 290 1.080E-46
8 phalp2_13106
8n51f
2 33,8% 192 1.598E-37
9 phalp2_12323
7wjSB
3 32,6% 184 2.177E-37
10 phalp2_32087
63Erl
43 29,2% 239 2.682E-26

Domains

Domains
Representative sequence (used for alignment): 7cyBj (291 AA)
Member sequence: 5hQpB (241 AA)
1 291 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01471, PF01520

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (7cyBj) rather than this protein.
PDB ID
7cyBj
Method AlphaFoldv2
Resolution 91.74
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50