Protein
- Protein accession
- 5fk5g [EnVhog]
- Representative
- 1MMvC
- Source
- EnVhog (cluster: phalp2_11679)
- Protein name
- 5fk5g
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MATWIRPVEGNITDSFDGHKGRTNPPSRNPGTDYGVPFGTVIKAPADGTVTGIIPTFRGSGGRMIFMSFPGGFNADFLHLHTIEVIEGQQVKQGQRIGLSGASGLGSERGYGAHLHFSFRKGGSPTMGEGNIDFEKMLTKTTEEKPVADKKPSKPKKAANTYTVVKGDTLTKIAKAHGSTVPELVKLNKIKDKNKISIGQVLKVS
- Physico‐chemical
properties -
protein length: 205 AA molecular weight: 21934,8 Da isoelectric point: 9,85 hydropathy: -0,45
Representative Protein Details
- Accession
- 1MMvC
- Protein name
- 1MMvC
- Sequence length
- 209 AA
- Molecular weight
- 21155,63010 Da
- Isoelectric point
- 9,79831
- Sequence
-
MTTYIRPVQAGISDNFAAHQARRSVNPGTDYVVGIGTPVVAVADGVVGGTVTHIGGAGGRMIFLDFPDGHNADYLHLSRIDVAPGQAVKQGQVIGLSGASGKGYERGYGPHLHFSFRHGGRHTTGAGNKDFEAVVSGGGAPAPAAAPASKPTVKKGSKGKAVAYLQSKLGITADGAFGPITDKAVRAFQTSKGLVADGIVGPKTWAAIG
Other Proteins in cluster: phalp2_11679
| Total (incl. this protein): 116 | Avg length: 218,0 | Avg pI: 9,72 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1MMvC | 209 | 9,79831 |
| 1JAxH | 222 | 9,66028 |
| 1JJCZ | 225 | 9,66073 |
| 1K1Kn | 226 | 9,98810 |
| 1K4s3 | 225 | 9,66028 |
| 1LP5T | 214 | 9,86297 |
| 1Mntk | 226 | 10,16197 |
| 1WAAv | 209 | 9,95825 |
| 1X06j | 213 | 10,13715 |
| 1gMOi | 282 | 4,76938 |
| 1hIII | 273 | 10,78216 |
| 1hUoG | 270 | 10,22522 |
| 30jqB | 228 | 9,77381 |
| 3dCAf | 242 | 9,27031 |
| 41UrE | 216 | 10,03910 |
| 44tmU | 210 | 9,91512 |
| 46GSH | 195 | 10,18731 |
| 46okJ | 211 | 10,08532 |
| 48aQO | 226 | 9,72836 |
| 48cey | 211 | 9,40866 |
| 49v3l | 205 | 9,83660 |
| 4HSmy | 299 | 4,35065 |
| 4J25V | 212 | 9,75408 |
| 4Yq32 | 223 | 9,78567 |
| 4ZPLf | 225 | 9,93930 |
| 4ZQOk | 157 | 9,75621 |
| 4ZZ33 | 214 | 9,95626 |
| 4aERH | 220 | 9,73107 |
| 4aP5d | 223 | 9,90739 |
| 4abjL | 205 | 9,83660 |
| 4agKH | 196 | 10,44757 |
| 4bm6J | 222 | 9,76221 |
| 4bxjP | 195 | 10,45292 |
| 4by3r | 197 | 10,16874 |
| 4l74k | 210 | 10,06514 |
| 4oHAX | 225 | 9,72842 |
| 4pDue | 222 | 9,81939 |
| 4pPGI | 213 | 9,83551 |
| 4pk0f | 225 | 9,81881 |
| 4rKrR | 217 | 9,57280 |
| 50FsN | 224 | 9,87090 |
| 50NG2 | 222 | 9,81997 |
| 50Ntg | 225 | 9,72791 |
| 51435 | 210 | 9,66673 |
| 51Ndj | 173 | 9,87212 |
| 51Nqk | 205 | 9,83602 |
| 51usi | 217 | 9,94104 |
| 52h4X | 225 | 9,76111 |
| 52vYQ | 224 | 9,85523 |
| 53mfo | 217 | 9,72688 |
| 53nec | 214 | 9,95626 |
| 55DDk | 214 | 9,92273 |
| 56A9E | 223 | 9,69606 |
| 56Ag1 | 226 | 10,07094 |
| 56FsU | 168 | 9,77742 |
| 56nSR | 205 | 9,83602 |
| 56ybS | 225 | 9,89643 |
| 57Muw | 186 | 9,77233 |
| 57MzN | 205 | 9,79347 |
| 585WH | 213 | 9,72333 |
| 58rHq | 225 | 9,76111 |
| 58rVy | 228 | 9,72688 |
| 5BNAH | 214 | 9,92273 |
| 5BNM2 | 175 | 9,73848 |
| 5BNZW | 224 | 9,79824 |
| 5EgRs | 225 | 9,76111 |
| 5a3Jt | 202 | 9,89108 |
| 5aHpI | 205 | 9,99449 |
| 5ahbD | 210 | 10,03226 |
| 5bQfF | 229 | 9,85588 |
| 5bjZp | 228 | 9,81881 |
| 5cgYz | 213 | 9,91512 |
| 5cvmE | 210 | 10,18131 |
| 5djIU | 220 | 9,94562 |
| 5eKjd | 168 | 9,75576 |
| 5eMZV | 224 | 9,79889 |
| 5fFgj | 225 | 9,74138 |
| 5gae2 | 228 | 9,81997 |
| 5gdGN | 204 | 9,87148 |
| 5gfkI | 228 | 9,72842 |
| 5h7yB | 226 | 9,78567 |
| 5hthQ | 162 | 9,86793 |
| 5it8z | 213 | 9,66634 |
| 5iv6f | 222 | 9,81997 |
| 5jf5P | 210 | 9,84982 |
| 5jhiG | 229 | 9,72417 |
| 5kTmL | 209 | 9,43239 |
| 5m3dr | 226 | 9,99088 |
| 5nrtu | 207 | 9,93092 |
| 5tAHf | 221 | 9,81939 |
| 5tCcm | 217 | 9,62889 |
| 5vVue | 226 | 9,89495 |
| 5wbfo | 205 | 9,87025 |
| 5ysGc | 225 | 9,78567 |
| 5z4Yl | 225 | 9,94717 |
| 5zTqB | 222 | 9,72991 |
| 5zUaw | 218 | 9,83686 |
| 5zi8P | 217 | 10,25068 |
| 6QiiA | 255 | 10,04213 |
| 6RqCE | 291 | 5,10996 |
| 6Ux0Z | 208 | 9,83602 |
| 6Ux0t | 225 | 9,98901 |
| 6y6HH | 219 | 9,90668 |
| 6yIqA | 228 | 9,87148 |
| 6yeVE | 225 | 9,76111 |
| 7G3A4 | 210 | 9,66634 |
| 7G3fp | 211 | 9,99487 |
| GkN2 | 224 | 9,73229 |
| Mj6Q | 223 | 9,76169 |
| Tjrv | 225 | 9,91577 |
| UnTC | 229 | 9,62972 |
| UnYw | 228 | 9,13048 |
| A0A6J5M709 | 221 | 9,78516 |
| A0A6J5MST5 | 214 | 9,84982 |
| A0A6J5N6B3 | 228 | 9,76169 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_29729
1mI3z
|
7 | 44,1% | 154 | 3.743E-39 |
| 2 |
phalp2_428
7zQ20
|
48 | 35,5% | 214 | 1.311E-38 |
| 3 |
phalp2_25483
3axoQ
|
3 | 38,8% | 206 | 1.442E-36 |
| 4 |
phalp2_21800
4e6HN
|
71 | 38,5% | 148 | 2.761E-28 |
| 5 |
phalp2_11281
6RW1f
|
1 | 37,2% | 137 | 9.610E-28 |
| 6 |
phalp2_40071
41qFE
|
139 | 32,2% | 158 | 1.563E-21 |
| 7 |
phalp2_14972
vSj7
|
5 | 32,0% | 212 | 7.355E-21 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1MMvC)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50