Protein
- Protein accession
- 5eNQk [EnVhog]
- Representative
- 48VB5
- Source
- EnVhog (cluster: phalp2_10825)
- Protein name
- 5eNQk
- Lysin probability
- 93%
- PhaLP type
-
endolysin
Probability: 54% (predicted by ML model) - Protein sequence
-
MDGSSSTVYANGILICREGDAATCGHPATGSGNVFSGTFASFVVPPVVIAPATQAAINRQTSAYVANPGAYNVASNDQVKQNFPGTPQGADGESLIDTDVVLASDIPSLLSQNLDEAGKGIWEETGMGGRASNPKITGIWKELGYPQSGAWLTDQTAWCMGYVNWVLKRCGYRFVQTAWAFDIKNKTAAYKAITIPLNQGQPGDIALWSYGHVNFIYTASSGTYSFVGGNQSTKAKNVNNPSSGSVTRSWPSGYRTPGDNSLIGIFRPVKE
- Physico‐chemical
properties -
protein length: 271 AA molecular weight: 28735,7 Da isoelectric point: 6,72 hydropathy: -0,23
Representative Protein Details
- Accession
- 48VB5
- Protein name
- 48VB5
- Sequence length
- 347 AA
- Molecular weight
- 35550,63020 Da
- Isoelectric point
- 4,93081
- Sequence
-
MPAVARTNVDAGGDIINSGSGDVIVNGNPCARKTDTVNPHDTVPSHTSGPPIVAGSGSVIVNGLECARVGDPVDCGHSISTGSNDVFAGDGSGGSSEPPATVFADEIPPSALFSGSPSPAVTISPAAQAVADSATRSYVANPSAYRLAPGTDEDNQVKQNYAGTVEDGGSGASIAPSAAAASDIPSFLRQVLSEAATGCWRETGQDGKQSNPNIVGIWPYLGYPKSGCWTTDQTAWCMGFVNFVLKNCGYRYVQTAGAKDIQNRTSAFGATSIPLDQGLPGDIVLWNYSHVNFIYSGGGGKYTFCGGNQSPKNKGNNPNDGDVTNSWPGGWTTAKGGIVGIWRPSKA
Other Proteins in cluster: phalp2_10825
| Total (incl. this protein): 128 | Avg length: 316,5 | Avg pI: 5,83 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 48VB5 | 347 | 4,93081 |
| 15glo | 288 | 6,55083 |
| 15l2t | 284 | 6,54537 |
| 15m8o | 325 | 5,06728 |
| 163Xj | 288 | 6,55083 |
| 17IHq | 280 | 4,81690 |
| 17L4X | 284 | 5,30827 |
| 18Kqq | 325 | 9,51652 |
| 1AyJ2 | 335 | 5,68176 |
| 1Cy3n | 279 | 5,76293 |
| 1EBdR | 348 | 4,65298 |
| 1GyJH | 325 | 4,35736 |
| 1OA9W | 402 | 4,69663 |
| 1Uvvo | 353 | 4,76802 |
| 1fGUc | 357 | 5,02953 |
| 1fHlq | 344 | 5,02942 |
| 1jzlU | 326 | 4,53373 |
| 1kyf5 | 339 | 8,48367 |
| 1pIw | 345 | 4,91557 |
| 1phWv | 278 | 5,08990 |
| 1t7Eb | 350 | 4,63706 |
| 22Drb | 357 | 5,02953 |
| 22ED3 | 345 | 5,02243 |
| 22TIl | 378 | 4,57130 |
| 26OGJ | 349 | 4,76586 |
| 27UY6 | 274 | 6,72527 |
| 284gM | 325 | 5,06728 |
| 285HA | 284 | 6,54810 |
| 286V5 | 273 | 6,73289 |
| 2ELaU | 284 | 8,34010 |
| 2KtYR | 328 | 5,32521 |
| 2ROTv | 331 | 4,56868 |
| 2YmY5 | 350 | 5,35943 |
| 2ZuJM | 279 | 5,35983 |
| 2ZwnV | 273 | 5,57542 |
| 2ZyCk | 278 | 5,64982 |
| 2btDO | 342 | 8,99445 |
| 2d0px | 323 | 9,59240 |
| 2faVm | 336 | 4,34804 |
| 2gGZY | 334 | 4,71578 |
| 2gsqC | 337 | 4,16888 |
| 2ih6n | 332 | 4,33252 |
| 2iwfS | 288 | 6,89232 |
| 2j7Y0 | 353 | 5,96096 |
| 2jcFr | 287 | 4,88994 |
| 2jlf6 | 336 | 5,77594 |
| 2lqFD | 284 | 6,39913 |
| 30J2w | 320 | 8,27208 |
| 30Yzl | 350 | 5,56627 |
| 310w7 | 287 | 5,01891 |
| 319fo | 281 | 5,75929 |
| 324Uf | 288 | 5,49255 |
| 33ZrJ | 293 | 6,57959 |
| 34LYm | 332 | 4,82332 |
| 3QR0Y | 343 | 4,99924 |
| 3RdK1 | 325 | 4,35736 |
| 3SBpO | 357 | 5,36238 |
| 3Wa96 | 343 | 4,61262 |
| 3b223 | 336 | 5,37125 |
| 43AEp | 354 | 4,64178 |
| 464iR | 300 | 7,58428 |
| 465jb | 284 | 6,72089 |
| 46v2B | 288 | 8,56483 |
| 47b8Q | 345 | 6,20235 |
| 47fLd | 287 | 8,50236 |
| 47p30 | 340 | 6,28676 |
| 481rD | 345 | 5,49857 |
| 4980O | 321 | 9,41246 |
| 49nnm | 350 | 4,69919 |
| 4FOfg | 282 | 8,20826 |
| 4PCXi | 337 | 4,54720 |
| 4WC68 | 332 | 4,36190 |
| 4WHlM | 326 | 4,30865 |
| 4WVNk | 349 | 4,82258 |
| 4fCGM | 275 | 6,71811 |
| 4fCkL | 282 | 6,29949 |
| 4ljmr | 337 | 4,72550 |
| 4lqRV | 274 | 5,82636 |
| 4oEHa | 288 | 5,24649 |
| 52fWo | 256 | 5,11900 |
| 55fOv | 320 | 8,29581 |
| 57pxP | 382 | 4,77592 |
| 598Os | 275 | 6,71561 |
| 5ExTt | 288 | 6,27442 |
| 5bE9W | 284 | 5,29173 |
| 5eqIc | 278 | 5,32316 |
| 5g8GY | 320 | 8,28775 |
| 5iGIN | 282 | 5,74417 |
| 5kUNN | 276 | 5,50170 |
| 5kWqA | 275 | 6,09674 |
| 5lo5B | 275 | 5,48612 |
| 5mJPh | 277 | 5,30424 |
| 5nppU | 278 | 5,62606 |
| 5ta5v | 357 | 5,03181 |
| 5zva7 | 327 | 6,90249 |
| 6Hf4I | 325 | 7,72495 |
| 6IC83 | 274 | 6,11272 |
| 6Jp4b | 344 | 5,10735 |
| 6LE30 | 287 | 6,72822 |
| 6M8cz | 273 | 5,77555 |
| 6MAvw | 325 | 5,51409 |
| 6MJaM | 347 | 5,01510 |
| 6NqMj | 324 | 4,23680 |
| 6QAsj | 337 | 4,99634 |
| 6TVmV | 337 | 6,21190 |
| 6VGau | 325 | 5,19158 |
| 6i2R | 351 | 6,98104 |
| 6yCvV | 283 | 6,04530 |
| 7XMmH | 302 | 4,83912 |
| 8B2MA | 346 | 5,21727 |
| 8mTPt | 285 | 4,74983 |
| 8vJGs | 327 | 8,88692 |
| 8y1Cs | 325 | 4,35736 |
| 8zO8E | 343 | 4,99924 |
| 8zZxf | 306 | 4,79087 |
| Bgfi | 374 | 4,34150 |
| FjP2 | 321 | 8,79711 |
| IJfG | 320 | 8,59326 |
| Lnm3 | 343 | 4,61262 |
| MpGg | 348 | 4,68537 |
| SWLr | 286 | 5,18829 |
| TYdV | 281 | 5,55399 |
| UyXL | 278 | 5,10485 |
| ZPL3 | 287 | 6,04087 |
| mRQ0 | 384 | 8,92341 |
| nWFK | 341 | 6,94370 |
| woZp | 345 | 4,88840 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_13349
474Yn
|
16 | 44,2% | 251 | 1.122E-77 |
| 2 |
phalp2_24581
50Pf2
|
17 | 37,5% | 336 | 2.284E-75 |
| 3 |
phalp2_40410
4ax6t
|
2 | 43,6% | 227 | 9.057E-53 |
| 4 |
phalp2_4183
1Z8th
|
12 | 24,9% | 441 | 7.475E-47 |
| 5 |
phalp2_31854
4CZWU
|
11 | 27,2% | 327 | 2.615E-34 |
| 6 |
phalp2_21577
2hnRm
|
3 | 27,0% | 355 | 5.395E-22 |
| 7 |
phalp2_11979
30VLF
|
51 | 25,0% | 260 | 3.826E-18 |
| 8 |
phalp2_32072
5Prvh
|
8 | 26,8% | 257 | 6.881E-18 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(48VB5)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50