Protein
- Protein accession
- 5ahFj [EnVhog]
- Representative
- 46ZD7
- Source
- EnVhog (cluster: phalp2_27264)
- Protein name
- 5ahFj
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MAAKKTSNRPYPYYPAKAGKGKLAGTEWFIHACNRRWGFKNLGSYVLRDMRGKPGQLSVHSTGAACDVGFAGKKPAEILKAWNWFMDHTRQLGIVEAHWYTAPGTKYGIGYRCSRGEGHAGCIEWTAQNNGGKGGAWFHLEFEMDFASSEKKMSEAWRSLPKPA
- Physico‐chemical
properties -
protein length: 164 AA molecular weight: 18275,6 Da isoelectric point: 9,64 hydropathy: -0,62
Representative Protein Details
- Accession
- 46ZD7
- Protein name
- 46ZD7
- Sequence length
- 170 AA
- Molecular weight
- 18796,12310 Da
- Isoelectric point
- 8,86622
- Sequence
-
MGYTGFDKIADAKIPATERLIDLCGRRWKFTNMGSLVVRVMRSAPADIQKLDVHDPKCKPYMSVHATGRAADIGFGADDKAAVQAMNWFVQYADQLGIEEVHDYGGRTKPGTSQWGRGWRVGRGWKDWTATDNGGTPGLGTKWIHVEISPAMAAKSADEYEAIWRSVPKP
Other Proteins in cluster: phalp2_27264
| Total (incl. this protein): 137 | Avg length: 165,0 | Avg pI: 9,47 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 46ZD7 | 170 | 8,86622 |
| 1JA7l | 179 | 9,54475 |
| 1JJhE | 180 | 9,36631 |
| 1JMC3 | 175 | 9,59549 |
| 1JXf8 | 175 | 9,72275 |
| 1Jqzv | 180 | 9,34271 |
| 1K1NN | 158 | 9,75453 |
| 1K99L | 178 | 9,22009 |
| 1KWN4 | 154 | 9,90242 |
| 1KiMv | 156 | 10,01447 |
| 1LeIb | 173 | 9,60909 |
| 1LkJ7 | 173 | 10,08680 |
| 1MrFA | 180 | 9,51632 |
| 1ayLV | 156 | 9,42716 |
| 1jyMj | 156 | 9,42716 |
| 1q3vE | 169 | 9,72636 |
| 1uKv5 | 188 | 9,18566 |
| 1wn6O | 151 | 9,16581 |
| 1yajt | 173 | 9,43729 |
| 219Gs | 157 | 9,39164 |
| 2GB1t | 174 | 9,74770 |
| 2GDHz | 157 | 9,56809 |
| 2Op1T | 155 | 9,82700 |
| 2RWSJ | 156 | 8,99194 |
| 2RXlH | 156 | 9,17258 |
| 2RXx2 | 156 | 9,51407 |
| 2cQss | 164 | 8,39496 |
| 2jb19 | 156 | 8,99194 |
| 2jmYc | 156 | 8,99194 |
| 2rnFp | 164 | 8,63427 |
| 30MsF | 156 | 9,07510 |
| 30bhI | 157 | 9,18425 |
| 31KT3 | 154 | 9,32382 |
| 3WrpC | 169 | 9,29894 |
| 44Gw2 | 169 | 9,40209 |
| 46OaW | 178 | 9,46578 |
| 46Osb | 156 | 9,36676 |
| 46zJB | 150 | 8,83160 |
| 48NT6 | 155 | 9,51374 |
| 498P3 | 174 | 9,40744 |
| 49bt0 | 156 | 9,13267 |
| 4A0mn | 155 | 10,35738 |
| 4Cj82 | 131 | 9,26109 |
| 4DG2k | 154 | 10,51842 |
| 4Gkmu | 163 | 8,71840 |
| 4IW9g | 178 | 9,38062 |
| 4V9JS | 156 | 9,42716 |
| 4bSYL | 156 | 9,51755 |
| 4bfYv | 167 | 9,36611 |
| 4bkEn | 165 | 9,33762 |
| 4fChQ | 174 | 9,40750 |
| 4fFle | 174 | 9,11881 |
| 4l3RI | 156 | 10,16713 |
| 4l666 | 151 | 9,30016 |
| 4ldyX | 156 | 9,42716 |
| 4m9b5 | 172 | 9,63520 |
| 4ogVn | 155 | 10,25352 |
| 4pg25 | 165 | 9,58814 |
| 4piGD | 173 | 9,68059 |
| 4pj4z | 174 | 9,83912 |
| 4qO3l | 156 | 9,42716 |
| 4r7sC | 150 | 9,84182 |
| 4sqjg | 173 | 9,43174 |
| 4zUFN | 169 | 9,78645 |
| 4zZpF | 155 | 10,28737 |
| 50FBT | 173 | 9,68059 |
| 50Inn | 188 | 9,24336 |
| 50pmn | 156 | 9,27760 |
| 53mgn | 191 | 9,39880 |
| 54RRG | 172 | 9,60935 |
| 54Tdy | 180 | 9,41530 |
| 54qxK | 155 | 9,96586 |
| 55GEw | 165 | 9,46488 |
| 55rlV | 180 | 9,32169 |
| 56H8n | 179 | 9,61818 |
| 56QHC | 161 | 9,02946 |
| 59hn0 | 156 | 9,40267 |
| 5C7CM | 156 | 9,32266 |
| 5DXP5 | 166 | 9,59543 |
| 5a7bR | 156 | 9,32266 |
| 5amt8 | 165 | 9,37939 |
| 5eQbl | 139 | 8,79163 |
| 5eVcZ | 178 | 9,58891 |
| 5eWZi | 178 | 9,51787 |
| 5ezjt | 155 | 10,15707 |
| 5f48m | 179 | 9,36095 |
| 5gkZN | 180 | 9,49260 |
| 5hqFS | 156 | 9,42684 |
| 5i5vM | 172 | 9,68098 |
| 5m17b | 156 | 9,45302 |
| 5mgYs | 174 | 8,88569 |
| 5tkgc | 178 | 9,38068 |
| 5uqaH | 188 | 9,18560 |
| 5v8Vx | 172 | 9,63559 |
| 5wNOR | 156 | 9,32266 |
| 5wgeS | 177 | 9,23866 |
| 5wuf1 | 156 | 9,40234 |
| 5x7oJ | 156 | 9,34303 |
| 5yvYB | 165 | 9,56235 |
| 5zdcb | 179 | 9,65345 |
| 5ze7w | 178 | 9,25697 |
| 6GSzF | 176 | 9,24930 |
| 6HEci | 180 | 9,39319 |
| 6IsVq | 165 | 9,44289 |
| 6Mc3c | 155 | 10,17603 |
| 6UCb6 | 176 | 9,51355 |
| 6UkEd | 173 | 9,30093 |
| 6xM0a | 165 | 9,69548 |
| 6y9Cq | 156 | 9,46185 |
| 7XKqI | 174 | 9,69464 |
| 80NyO | 154 | 10,02704 |
| 80nE2 | 154 | 10,02253 |
| 8DgJX | 156 | 9,24852 |
| 8b1sd | 150 | 9,90571 |
| 8mBhK | 174 | 9,37778 |
| 8mqZE | 172 | 9,46146 |
| 8mr2e | 158 | 9,77336 |
| 8msDS | 174 | 9,11991 |
| 8mw0T | 155 | 10,12974 |
| 8s6RY | 174 | 9,58705 |
| 8ssQD | 169 | 9,27244 |
| KTKk | 155 | 9,59981 |
| KVSU | 156 | 9,82107 |
| KeLp | 156 | 9,75943 |
| LdUn | 173 | 9,41556 |
| SYSy | 180 | 9,34271 |
| TR5R | 156 | 9,29952 |
| U8NA | 156 | 9,46159 |
| UdKd | 180 | 9,43716 |
| UkhR | 180 | 9,18612 |
| hPX2 | 156 | 9,32266 |
| qCdP | 156 | 9,48087 |
| sAuH | 172 | 9,61818 |
| tBmB | 169 | 9,29790 |
| uKOt | 158 | 9,17419 |
| yNvt | 134 | 9,51774 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_36358
qD4l
|
947 | 39,6% | 174 | 3.260E-47 |
| 2 |
phalp2_15195
B9iS
|
156 | 47,5% | 122 | 2.257E-40 |
| 3 |
phalp2_4433
2R1uw
|
426 | 34,2% | 175 | 3.192E-34 |
| 4 |
phalp2_36082
6xZKL
|
58 | 39,6% | 111 | 7.459E-27 |
| 5 |
phalp2_1708
2iIeV
|
1834 | 34,6% | 179 | 1.912E-26 |
| 6 |
phalp2_1503
1ZCI1
|
63 | 30,8% | 133 | 2.427E-17 |
| 7 |
phalp2_21895
4GkAF
|
131 | 31,9% | 144 | 5.465E-16 |
Domains
Domains
1
170 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(46ZD7)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50