Protein

Protein accession
5ae5t [EnVhog]
Representative
2j3QA
Source
EnVhog (cluster: phalp2_26654)
Protein name
5ae5t
Lysin probability
94%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MCIALITTALSATPSKAYGEELVMDWRFYRRLAMCETGANVNHSTKSYTSMYGISRGVWQAWSNRSSAAGLSALQQARVVDNIAFEGHWSRGVYKHPVGPWGWGVVKSNCRNLQQLLCQSKHPLVQRWKRNCK
Physico‐chemical
properties
protein length:133 AA
molecular weight:15048,1 Da
isoelectric point:9,92
hydropathy:-0,36
Representative Protein Details
Accession
2j3QA
Protein name
2j3QA
Sequence length
146 AA
Molecular weight
15992,21040 Da
Isoelectric point
10,03188
Sequence
MAIALITAISIPAPAFAAAPHDPFQKYHGILPDAYYLGLARCETGNNPNHSTLSYTGMFGIYRPTFKHWSNFSSAKGMTPRQQVKVADAIAFKGHTNPDGSRAPAIGVWGWGCVKGQKSLQAFICRSRHTLVARWKRGCGTVHKHQ
Other Proteins in cluster: phalp2_26654
Total (incl. this protein): 256 Avg length: 143,2 Avg pI: 10,08

Protein ID Length (AA) pI
2j3QA 146 10,03188
17HID 150 10,13728
18biV 137 10,18905
19I6x 146 9,82899
19Ia6 146 9,72920
1IVqW 196 11,39764
1JmzR 142 9,87109
1K309 141 9,82899
1K4jQ 146 10,07256
1K6qo 136 10,02943
1K9Ox 146 9,93614
1KaMd 138 10,07365
1Lm6q 151 10,12291
1M2LF 196 11,39764
1Mkr8 137 9,75872
1Mldc 159 10,42230
1MubX 144 9,34110
1NZza 138 9,97669
1QH90 144 10,02382
1aE1I 146 10,07036
1ayLT 146 9,93543
1eAtk 144 10,20136
1gXLF 156 9,26032
1h1e3 133 9,92086
1q2EF 137 10,07881
1q7ua 129 10,18170
1rWTq 155 10,08680
1uQDt 157 10,40399
1vDir 137 9,97669
1wm3H 116 9,97766
1zep1 196 11,45005
1znjI 144 10,07759
25h1u 103 9,83963
25hmQ 137 9,90629
2RX5A 145 9,92982
2RhEm 110 10,30013
2Wif6 138 10,08261
2YAPF 146 9,97921
2YBtQ 138 10,12684
2YFmR 151 10,12291
2YGdg 146 10,20427
2j7Dk 145 9,76698
2j91W 176 10,67849
2jhz1 150 9,84821
2jjEn 141 9,86955
2jw9v 147 10,49528
2kQHN 147 10,63827
306rJ 149 9,97482
30isQ 149 9,82629
30oLr 146 10,08010
30smM 137 9,92899
30t56 146 10,08010
30tB8 137 9,93066
31GrR 149 9,60735
31JJ4 146 10,07256
31N2w 149 9,91545
33BXb 145 9,87348
33wiN 127 9,75866
37fMr 144 10,12162
38nqY 149 9,97186
38o7V 144 10,10105
3Uyqc 133 9,97972
3YuS3 143 10,20298
46AzQ 141 9,97566
46CHw 130 9,87541
46MSA 140 10,02530
46N96 137 10,18905
46UzQ 140 9,97689
46tS8 136 9,97669
477er 143 10,22676
48MK3 142 9,75073
49J74 148 10,06817
49XUi 140 9,97044
49uQP 137 10,07365
4AD6K 150 10,07765
4Ac1q 131 11,39255
4DIXG 138 10,14186
4GCAH 144 10,11143
4GjHW 154 9,82635
4IYes 110 10,09112
4NB4M 146 10,06546
4Ns1f 146 10,02440
4Nyg3 146 9,97921
4XnEC 148 9,98785
4YsAs 129 9,97830
4ZXUI 137 10,30252
4bQLS 147 10,15765
4bQf0 141 9,82764
4bnQs 138 10,18737
4bu3C 150 10,14773
4c0Rp 140 10,08693
4e8Kd 137 10,26609
4fChC 145 10,29265
4fFKl 141 10,25307
4fFkV 158 10,58257
4gi64 146 9,94136
4h2ww 145 10,16823
4l5ob 144 10,73690
4l87c 141 9,86955
4mFEs 133 9,96689
4mbz6 146 10,57934
4nUif 174 9,91899
4nwFF 140 9,93066
4oec7 154 10,29304
4oxEd 146 9,98198
4pBiu 146 9,93543
4pg5w 143 9,89333
4plGy 138 10,32837
4pmzQ 132 10,07881
4qQ49 118 9,93543
4qhos 142 10,06566
4qr05 138 9,87270
4rONk 150 10,29594
4rOSr 133 9,84879
4s07J 159 10,19995
4sb9B 145 10,16758
4wtIn 167 9,76388
4zMzS 154 10,47381
50583 138 10,07256
511Vm 137 10,07256
51TB8 159 10,32443
51rJJ 138 9,92086
51uEn 137 9,87270
51vHo 130 9,67466
53Vpq 173 10,32837
53Wst 138 10,02717
53YGM 137 10,02717
54Sp9 150 10,37678
54UY1 142 9,67201
54ZAG 138 10,41875
54pdK 157 10,20136
550Va 142 10,02511
55qpD 146 9,93543
55tip 142 9,97379
55xnw 146 10,41643
56Akb 144 10,20285
56I3l 146 10,37981
56KrZ 116 10,03516
56LcP 137 10,02717
57f9i 144 9,92654
57zrQ 137 10,07256
58l0w 138 10,16668
58nSC 137 9,88624
58pM2 156 10,20588
58tnB 146 10,06469
5957P 140 9,72752
59Dog 150 10,29820
59YGI 137 9,83106
5AGlv 146 9,98037
5AHe7 137 10,02717
5BGrQ 155 11,19373
5BtcV 143 9,80837
5DJpc 141 9,87032
5DwwK 158 10,29291
5a5qF 146 9,94298
5aBgH 138 9,98011
5aCgP 149 9,91545
5aDd1 127 9,97244
5aHpZ 133 9,97972
5aWKm 157 10,40399
5bF3u 141 9,76504
5bGTY 148 10,02820
5bHIZ 148 9,91545
5bINs 138 9,97921
5cyR3 155 11,19373
5dveq 137 10,02717
5eAyj 135 10,34571
5eN5F 142 10,06450
5eUPA 116 10,03065
5eVBZ 163 10,36963
5eqdQ 142 10,02949
5fBin 146 9,93543
5fTD0 146 9,93543
5gATe 148 10,02923
5gKfl 146 10,10305
5gjch 143 9,92866
5gnEu 146 10,10305
5gv5t 137 10,12819
5gzqy 144 10,15018
5h6qT 137 10,12690
5h922 116 10,09112
5hBOH 138 9,97669
5hyU3 146 10,15011
5iMAg 151 10,29375
5iSC5 144 9,34110
5itdB 129 10,07636
5mhhR 140 10,02575
5mieQ 157 10,13722
5moi8 147 10,44241
5ntJJ 150 10,02614
5ntU3 149 9,86955
5ntkh 145 10,10318
5tJMR 149 9,80579
5tkB1 146 10,11253
5tkg9 110 10,21406
5uFrH 133 10,11388
5utmT 143 10,07971
5vlZO 137 10,24043
5wQmN 141 9,72752
5x7FM 146 9,89720
5xTWy 129 9,96754
5xbyo 149 9,86955
5z8vw 110 10,34249
5z97b 144 10,20285
5z9Rw 137 9,98011
5zVi3 138 10,02943
5zdca 116 10,09112
6IHcp 143 10,13728
6Mide 138 10,15037
6xNZz 150 9,97830
6xTsr 142 9,79199
6xlsM 138 9,97921
6y0zJ 146 9,90713
6ybaF 138 10,02440
6zclm 163 10,51300
7Vydq 145 9,83989
80Kll 143 9,98043
80iu9 145 10,21200
81sM3 146 9,88624
83F6A 145 9,97766
83cIC 154 10,60661
87bZe 169 10,10963
87tUL 136 10,08010
89pyF 157 10,35976
8e0zE 138 10,19073
8ecCe 138 10,08390
8nl0I 145 10,37027
8o6tr 146 10,07146
8oheu 157 10,12716
8osNm 138 9,97360
8t397 157 10,46472
FlHb 144 10,02408
H1ER 133 10,02459
Hagh 158 10,29291
IDSg 133 10,04851
LSHl 145 10,05264
Mkgs 142 10,44660
Mrth 113 9,40789
QaDy 146 9,78032
SX1H 137 9,98004
SYbT 142 9,97747
SvDQ 149 9,96315
UeKI 141 9,76504
UkhS 142 9,80798
Ukud 146 9,92899
hPTM 141 9,72752
hQjT 138 10,11607
hQqT 144 10,10105
iXmg 110 10,10743
qBV5 139 10,23959
qDHd 143 9,88727
A0A6J5MPV2 146 9,89675
A0A6J5MWU6 191 10,14425
A0A6J5P8B2 142 10,14186
A0A6J7X355 143 10,25732
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_34769
3jxtZ
24 57,1% 126 2.186E-54
2 phalp2_9748
88qrj
107 36,1% 130 2.352E-28
3 phalp2_34704
2W6sQ
31 30,9% 97 1.616E-18
4 phalp2_13237
2YlS3
12 25,7% 105 1.787E-16
5 phalp2_7734
6U1kO
4 29,9% 117 3.528E-11
6 phalp2_16092
4bDNE
28 26,7% 112 1.812E-06

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 2j3QA (146 AA)
Member sequence: 5ae5t (133 AA)
1 146 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (2j3QA) rather than this protein.
PDB ID
2j3QA
Method AlphaFoldv2
Resolution 88.33
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50