Protein

Protein accession
5aaNY [EnVhog]
Representative
6IDp9
Source
EnVhog (cluster: phalp2_3862)
Protein name
5aaNY
Lysin probability
88%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MLDVAPFLIEPSTTTSSTLFIDPYATAPAQFAALAVNLGWPVSEYNQLIKVITRESNGIAISHNKKDPMTGSYGLMQINGFWCRGENSFLQKAGLLTSCKMLLDPQVNLRAGLIIFNRSGWSPWRTAQ
Physico‐chemical
properties
protein length:128 AA
molecular weight:14122,1 Da
isoelectric point:8,68
hydropathy:0,02
Representative Protein Details
Accession
6IDp9
Protein name
6IDp9
Sequence length
158 AA
Molecular weight
17604,02840 Da
Isoelectric point
9,10082
Sequence
LLKRIIASFVSLIALGATVAVAEQPSAEGTPSSTINIRNIREALPPITIPSTALQGKWWGLARQVGWAEKDLLILDFVIDRESRGDNKAWNRQDPFGGSRCILQINGSWTKWLREKDILQRPADLFNPTVCLTAGLAIHQYGMDRYGWGWNPWAIPAP
Other Proteins in cluster: phalp2_3862
Total (incl. this protein): 274 Avg length: 164,1 Avg pI: 6,62

Protein ID Length (AA) pI
6IDp9 158 9,10082
16n4r 143 6,55788
192FX 156 8,72820
19I3Q 163 6,03615
1DLA1 158 9,19759
1JTfG 164 4,99702
1Jqpd 155 9,61902
1K379 157 6,09339
1K3eN 157 7,73229
1K65l 169 5,07023
1Ke3A 163 5,26428
1Kk6D 157 9,38893
1MpVj 163 6,55362
1OAJ9 163 9,20075
1WU0D 169 4,67082
1ZFio 158 9,35670
1aCdS 168 7,68994
1aXZN 169 4,73295
1iMwD 158 9,32666
1peit 168 6,55737
1rWlR 173 6,10584
1soGz 158 9,00032
1uPe8 156 9,33794
1ywla 169 4,55470
20y83 163 7,76326
20yms 157 9,26116
25OuX 168 6,81911
26K7D 158 8,92721
27M9w 158 9,32685
27VHs 157 8,97376
27usH 158 7,01395
2KxQd 169 4,59097
2LLAa 163 5,37597
2RTx7 156 9,14021
2RjMp 163 6,10391
2XyaE 166 5,04403
2Z7iu 158 9,19746
2ZSyK 168 5,07216
2hYGF 164 7,66811
2hYpu 128 7,84595
2ircM 158 7,01242
2j6Wm 155 8,75547
2q9Dk 163 5,37068
327uf 168 5,10792
33ZAz 169 4,67810
3470a 160 6,28630
38hEU 163 6,71799
38pXH 157 9,10082
3QpiZ 163 4,74994
3QqrU 168 4,73335
3Xqbs 169 4,80815
3Y0PY 169 4,91262
40sHn 120 4,83458
45Rmp 157 6,72453
45VbY 161 5,44724
45WBc 168 5,75736
45XdK 168 6,56811
46H0b 168 6,56379
46dIx 158 8,57953
46fmS 156 7,77813
46hCb 163 6,74636
48J8U 178 7,63179
49BMr 159 9,46565
49Bhb 163 6,28738
49FSC 169 4,99339
49GvY 169 8,77345
49Umd 171 6,28056
49Zow 163 6,10402
49a4H 168 6,55634
49aqj 168 6,55896
49b5S 169 4,69720
49hIq 163 5,74559
49qCV 157 6,72203
49wpI 156 8,61699
49yhX 169 4,55953
49zke 169 4,64257
4Abog 168 4,40465
4AhJp 164 4,99702
4Axcj 158 8,95016
4D6Hv 169 4,55470
4DJPR 158 9,19759
4DO8w 157 9,46462
4DSy9 138 7,78573
4GD5M 178 5,69825
4GezC 168 6,56777
4Ghgb 168 6,56339
4IYWi 168 5,28451
4NC1m 163 9,00657
4NmPl 161 6,26601
4Nqq8 163 6,55788
4OBYk 157 9,29765
4a0me 156 7,77813
4aJOv 162 7,78335
4aLkD 169 4,80815
4aSPZ 199 6,99406
4aUbx 199 6,15409
4aqKv 156 8,61699
4b2mU 168 7,66732
4bfMi 156 9,26084
4bn2Y 142 4,97446
4br8h 178 7,69119
4bzK8 169 4,78018
4ccyi 178 9,03004
4fC03 157 8,97376
4fyEJ 163 6,54600
4ghvZ 169 5,04215
4ghwo 168 7,68994
4lqbI 163 5,75781
4mB31 169 4,98486
4mK6z 128 4,83202
4mnIV 168 7,69443
4nHU7 164 5,21108
4nJvy 178 8,41063
4nW0y 178 8,77378
4nxzx 179 5,22966
4oQqw 164 6,56777
4ogCu 138 8,63833
4ordX 179 4,74204
4p0yI 179 4,73448
4pmjs 169 4,45898
4qvLR 179 5,03937
4rET5 157 9,29765
4wiNW 156 8,61583
4zCEV 157 9,02920
4zSUs 169 4,59097
4zX7U 157 9,22692
4zmFL 179 4,86118
505Ht 168 5,78015
505YK 178 8,43609
506rO 169 6,54111
50eb8 167 5,75736
51L2A 178 9,15240
51tfg 179 4,71061
51vlO 168 8,44705
52Kq4 179 4,85021
52X9N 156 4,25590
52YFe 177 4,78177
52mqI 126 8,64065
540yZ 169 4,78018
54Ftw 169 9,19875
54QaM 157 9,38790
54YY3 179 5,04573
557v9 169 4,43250
55snP 163 6,09231
56FKZ 169 4,81099
56gbO 169 4,55953
56l5w 169 5,60338
56vsu 169 6,56129
56yMi 143 5,38137
575OZ 158 9,19759
57HmC 179 4,69185
57Njp 163 5,04153
58VTs 157 6,09339
58sA9 169 4,80951
59PQe 178 4,51253
5Au8m 177 4,86840
5C6u3 157 6,09339
5CdBG 179 4,60910
5HmjU 164 8,95029
5aVbP 179 5,03937
5auED 142 5,08484
5b3k1 169 4,45898
5b725 169 4,46677
5b7YC 179 4,60910
5dYnx 169 4,46944
5eYAg 169 4,40573
5fD5S 169 4,89676
5fIjm 169 4,53271
5fN66 156 7,75644
5fn4D 168 5,02163
5gk8i 169 4,58579
5h8kC 163 5,80823
5hvfW 125 6,89493
5hx9b 179 5,02107
5hxkh 179 5,20926
5i8Y3 177 4,97702
5itdE 179 4,69816
5ivXY 169 4,55953
5izLN 179 6,56305
5mXU3 178 6,27402
5mYwh 179 5,26746
5mgX6 157 8,58044
5nWAU 179 4,89676
5nY47 179 5,03937
5npL2 169 6,54918
5o1sp 169 4,36617
5oo5L 168 7,66749
5tqnv 177 4,69185
5udS7 179 4,60910
5usq4 156 5,29520
5v3GW 179 4,75762
5vMB6 179 5,52909
5vNJw 179 5,13929
5vPbW 156 8,61815
5vQcf 168 4,61143
5vcLs 179 4,67082
5vl0h 169 4,81099
5wRBh 163 5,28883
5wVJ1 169 6,54884
5wYNM 168 5,09103
5wYWu 169 4,42914
5wacP 169 4,64257
5wohi 158 9,19759
5y329 169 4,64257
5yAUC 177 4,74369
5yTmq 169 9,03075
5zatK 163 5,37068
6ACMX 169 4,55953
6ACPf 177 4,86845
6AsJK 163 5,81312
6GMYW 138 7,75678
6GgbY 157 8,97376
6HpCC 158 8,95016
6HqNN 142 5,13008
6IukA 168 6,55737
6SWnM 163 9,65300
6xhGj 142 5,82034
6xmPr 157 9,02920
6xnDq 164 5,25337
6xsGk 169 4,83770
6ylZs 158 9,19746
6yr9p 158 9,10082
6z8HK 169 5,10792
6zQCX 158 9,00032
7UYcK 158 8,66740
7Vtaj 162 6,59067
7X2Xs 157 7,80192
7Xcph 163 7,68392
82OuU 157 6,72408
87wRe 163 5,40979
88eNx 162 7,75462
88ff8 163 8,44686
8F6he 163 5,74565
8epnG 157 6,72408
8gjeY 156 9,17915
8hJIG 168 4,58187
8mWzB 157 8,63942
8mmtp 163 6,56703
8mtRE 169 4,64257
8mvuN 168 4,66912
8my4t 162 6,56129
8nT19 157 9,13448
8nVl5 171 6,06537
8nnj9 163 7,67300
8rCVi 168 5,32748
8ra2i 168 6,55771
8sc7k 157 9,13448
C8Vq 168 6,55737
Cfea 158 7,01395
GQJx 178 6,07566
J9kL 163 7,77832
KXSm 168 8,47342
LERB 162 8,95642
LNw1 169 8,59829
Qbm4 156 8,75547
QrmJ 179 4,98628
S0Vx 156 8,72846
SoYx 124 6,56936
SslG 163 8,59932
TT7R 132 8,85578
U9Zc 163 8,65625
U9o2 169 5,04403
azDm 163 5,28451
dRZ9 163 4,88568
dS7N 158 9,27315
e97o 171 6,81604
hPad 158 7,01248
hPlv 156 9,00064
jJUC 158 9,16961
jSvN 168 5,30356
sR1J 157 9,50859
xebo 158 7,80353
A0A1B0XUA8 157 7,75582
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_8391
CgjB
207 46,1% 117 5.658E-55
2 phalp2_34455
4DPBl
20 33,7% 169 1.094E-41
3 phalp2_8459
165nm
626 41,3% 116 1.915E-37
4 phalp2_10602
5BOvL
251 39,2% 112 9.256E-37
5 phalp2_26521
7XVtu
369 32,5% 163 1.430E-34
6 phalp2_39019
8jV1G
364 34,5% 142 2.479E-30
7 phalp2_3718
5j50L
31 32,4% 111 1.085E-19
8 phalp2_27902
jLnT
10 32,6% 104 3.797E-19
9 phalp2_13239
2ZQKU
4 27,4% 113 5.193E-19
10 phalp2_33775
1865r
7 28,5% 126 4.149E-17

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 6IDp9 (158 AA)
Member sequence: 5aaNY (128 AA)
1 158 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (6IDp9) rather than this protein.
PDB ID
6IDp9
Method AlphaFoldv2
Resolution 81.91
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50