Protein
- Protein accession
- 5TIGn [EnVhog]
- Representative
- 5KvkK
- Source
- EnVhog (cluster: phalp2_5899)
- Protein name
- 5TIGn
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
ISNNNSYAGQTPLYIVIHNTDNTAKTADAKAHATAQHNGNFHGYSAHVFVDDKSAYQALPYNRGAWHVGVNYGGKLFGTVNNHNSIGIEMCMNAGYNYEKAFQNTVDVCKQLMKKYGIPASRVVQHYDVCAKNCPSVIRGKGDWNRFKKLISSETVTAPTTKPTVKVDKYYRVRKTWKDSKSQIGAYKSLKNAKKACKAGYSVFDWNGKAVYSVTAKKSVAKVAKEVINGEWGNGQDRKDRLEAAGYNYTEVQNAVNKLLK
- Physico‐chemical
properties -
protein length: 261 AA molecular weight: 29006,4 Da isoelectric point: 9,65 hydropathy: -0,64
Representative Protein Details
- Accession
- 5KvkK
- Protein name
- 5KvkK
- Sequence length
- 314 AA
- Molecular weight
- 35460,00570 Da
- Isoelectric point
- 9,67917
- Sequence
-
VATTAMIPRNLIMVGILYKEFMLKSTPNGVLFIMHFFNLNNERRTYMNINTSLISNNNSYAGQTPRYIVIHNTDNIAKTADAKAHATAQHNGNFHGYSAHVFVDDKSAYQALPYNRGAWHVGVDYGGKLFGTVNNHNSIGIEMCMNAGYNYEKAYQNTVDVCKQLMKKYNIPAFRVVQHYDVCAKNCPSVIRKNGDWDRFKKLISSETVTAPTTKPTVKVDKYYRVRKTWKDSKSQIGAYKSLKNAKKACKAGYSVFDWNGKAVYSVTAKKSVAKVAKEVINGEWGNGQDRRDRLESAGYNYTEVQNAVNKLLK
Other Proteins in cluster: phalp2_5899
| Total (incl. this protein): 133 | Avg length: 277,2 | Avg pI: 9,61 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 5KvkK | 314 | 9,67917 |
| 1oc0K | 268 | 9,72862 |
| 2lYNt | 268 | 9,58260 |
| 3AsMZ | 268 | 9,70367 |
| 3BT4f | 268 | 9,60065 |
| 3GPLa | 268 | 9,64391 |
| 3IUBd | 268 | 9,53953 |
| 3l32f | 308 | 9,72539 |
| 3lRFj | 268 | 9,64030 |
| 3lThr | 268 | 9,65248 |
| 3ligO | 268 | 9,71682 |
| 3mutX | 268 | 9,61257 |
| 3oRaE | 268 | 9,62437 |
| 3oaHB | 308 | 9,61335 |
| 3rPCR | 308 | 9,67943 |
| 3sJ56 | 268 | 9,53979 |
| 3tMna | 287 | 9,11262 |
| 3tabE | 268 | 9,67717 |
| 3uBmg | 268 | 9,57125 |
| 3uJhf | 268 | 9,62418 |
| 3xwgT | 343 | 9,56764 |
| 3yz04 | 268 | 9,57106 |
| 5KLr7 | 268 | 9,64010 |
| 5KhQr | 293 | 9,74145 |
| 5KwHq | 268 | 9,62437 |
| 5Lu7x | 268 | 9,55984 |
| 5Lu8i | 268 | 9,60690 |
| 5M3G5 | 268 | 9,57106 |
| 5M6jB | 293 | 9,66608 |
| 5MGLQ | 293 | 9,69110 |
| 5MIvz | 268 | 9,65229 |
| 5NlMM | 268 | 9,60065 |
| 5NoVK | 268 | 9,61238 |
| 5OncH | 268 | 9,65209 |
| 5PWVT | 268 | 9,58260 |
| 5PZlt | 268 | 9,66447 |
| 5QIQ5 | 268 | 9,51723 |
| 5R0W0 | 302 | 9,74893 |
| 5R9O2 | 293 | 9,73893 |
| 5RNJ4 | 268 | 9,57125 |
| 5RZI6 | 308 | 9,69116 |
| 5RaNP | 293 | 9,66628 |
| 5S7YI | 268 | 9,58260 |
| 5SdZE | 308 | 9,70296 |
| 5TMcz | 268 | 9,63179 |
| 5U806 | 302 | 9,73681 |
| 5UVfL | 268 | 9,62863 |
| 5V4Lj | 268 | 9,58247 |
| 5VHtn | 268 | 9,64030 |
| 5VhFB | 268 | 9,49466 |
| 5W1W9 | 268 | 9,58260 |
| 5WDAK | 268 | 9,53953 |
| 5WVIw | 268 | 9,55114 |
| 5Wdor | 268 | 9,60065 |
| 5X34r | 302 | 9,67904 |
| 5Xrgl | 308 | 9,69097 |
| 5XtiV | 268 | 9,60065 |
| 5Y5BO | 268 | 9,53953 |
| 5Ys3Z | 268 | 9,49498 |
| 5Z2gf | 268 | 9,65209 |
| 5ZCGj | 268 | 9,53966 |
| 60lMg | 268 | 9,61225 |
| 61mrN | 268 | 9,58949 |
| 63bMI | 268 | 9,65209 |
| 64VB5 | 268 | 9,52838 |
| 64xnl | 302 | 9,78284 |
| 666pP | 268 | 9,61225 |
| 67hl9 | 268 | 9,67846 |
| 68sxJ | 268 | 9,67859 |
| 69UAn | 268 | 9,56016 |
| 6Wfmz | 269 | 8,55445 |
| 6aWSk | 293 | 9,63611 |
| 6anJj | 293 | 9,71585 |
| 6bJv3 | 268 | 9,69084 |
| 6cBvU | 293 | 9,72823 |
| 6cJF6 | 268 | 9,55094 |
| 6dpWV | 287 | 9,30023 |
| 6duqQ | 268 | 9,58260 |
| 6fK29 | 268 | 9,61225 |
| 6fQ84 | 268 | 9,64030 |
| 6ftOr | 268 | 9,65229 |
| 6gHTg | 268 | 9,57125 |
| 6gj8i | 293 | 9,75176 |
| 6grck | 268 | 9,53966 |
| 6h31q | 302 | 9,70283 |
| 6hgNP | 268 | 9,63662 |
| 6iTSx | 268 | 9,59465 |
| 6iX5K | 268 | 9,58279 |
| 6ioFC | 268 | 9,57138 |
| 6jagd | 268 | 9,58279 |
| 6kLXX | 268 | 9,61238 |
| 6kbdO | 293 | 9,70328 |
| 6kwtv | 293 | 9,76524 |
| 6lMHl | 268 | 9,64030 |
| 6lyHR | 293 | 9,66408 |
| 6mVDp | 268 | 9,48409 |
| 6nUwm | 302 | 9,71476 |
| 6nwct | 268 | 9,56003 |
| 6oH23 | 293 | 9,77433 |
| 6oV9s | 268 | 9,61238 |
| 6okE7 | 268 | 9,71508 |
| 6pER1 | 268 | 9,69084 |
| 6pjkk | 268 | 9,39860 |
| 6qxlN | 268 | 9,69103 |
| 6rbVl | 268 | 9,61238 |
| 6rvqY | 268 | 9,62418 |
| 6sYwf | 268 | 9,53966 |
| 6tK08 | 298 | 9,69148 |
| 6tMBh | 268 | 9,61238 |
| 6tod1 | 268 | 9,64030 |
| 6uEuo | 268 | 9,55101 |
| 6ueD3 | 268 | 9,69103 |
| 6v9nb | 268 | 9,53966 |
| 6wArA | 268 | 9,65209 |
| 6wu8Z | 268 | 9,57222 |
| 7VHcr | 268 | 9,55101 |
| 7X9p8 | 268 | 9,61490 |
| 7Y4Ox | 268 | 9,61238 |
| 86sFP | 268 | 9,63662 |
| 8eMK5 | 268 | 9,64030 |
| 8eV2K | 268 | 9,53966 |
| 8kdVN | 477 | 9,59813 |
| 8m1n3 | 268 | 9,65229 |
| 8pgZZ | 293 | 9,65196 |
| BAmE | 268 | 9,49479 |
| EF2u | 268 | 9,69103 |
| Orj9 | 268 | 9,69084 |
| ykHl | 268 | 9,69084 |
| zaEa | 302 | 9,48383 |
| A0A8S5Q394 | 268 | 9,66447 |
| A0A8S5R9J3 | 268 | 9,60078 |
| A0A8S5VUI1 | 268 | 9,69103 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_26828
3TOBT
|
44 | 48,7% | 283 | 2.604E-65 |
| 2 |
phalp2_26224
op4C
|
2 | 37,7% | 233 | 1.493E-45 |
| 3 |
phalp2_32070
5P7Lm
|
156 | 35,0% | 328 | 1.453E-38 |
| 4 |
phalp2_7826
aMK
|
29 | 38,8% | 211 | 4.318E-37 |
| 5 |
phalp2_11417
eYHn
|
21 | 34,7% | 273 | 5.944E-35 |
| 6 |
phalp2_14834
7s5S0
|
47 | 33,9% | 271 | 6.944E-34 |
| 7 |
phalp2_36039
5QA7W
|
56 | 36,4% | 222 | 1.058E-28 |
| 8 |
phalp2_14662
5ObrM
|
161 | 36,5% | 216 | 1.435E-28 |
| 9 |
phalp2_17183
3bJIf
|
458 | 31,9% | 272 | 1.151E-25 |
| 10 |
phalp2_2897
yopH
|
100 | 25,8% | 255 | 1.806E-09 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(5KvkK)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50