Protein
- Protein accession
- 5T6Ku [EnVhog]
- Representative
- 7VlRi
- Source
- EnVhog (cluster: phalp2_11769)
- Protein name
- 5T6Ku
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 97% (predicted by ML model) - Protein sequence
-
MISNCGHDENGRYSGGKAGDQTGTEWRVINWYNRPWKCVLRHPNADVRAMIASMAKAAANNNLIGYDQSQRGTFWTNLADSNYDPAQITVACEADCSSGVAAIVKGAGYRLGIDALKKVSTACYTGNLRAALKAAGFEVLTESKYLTSDAYLFAGDILLNDNAHVATNLTTGSKASGTSAPSKSINEVAKEVINGKWGNGSDRTNRLTAAGYDAKAVQNEVNRILKGNATTPSKSINEVAKEVINGKWGNGSDRTNRLTAAGYDAKAVQNEVNRILR
- Physico‐chemical
properties -
protein length: 277 AA molecular weight: 29613,7 Da isoelectric point: 9,11 hydropathy: -0,45
Representative Protein Details
- Accession
- 7VlRi
- Protein name
- 7VlRi
- Sequence length
- 263 AA
- Molecular weight
- 28554,71370 Da
- Isoelectric point
- 8,48954
- Sequence
-
MISSCGHDENNKYKGGKAGDQTGTEYYVRAWYAPSYGWDCVLRHPNTRVGAKLAEIAQQAANNNKIGYDQNERLTYYNQLKAMGWHPDRITTACESDCSASTAAAVIATGHQLGLTKLQQVSPSLTTYGMKVALINAGFECLTESKYRTSDKYLLAGDIILNEQHHVIINLTKGSGAGSQTTSTAVEDMKTVTQYAAIVDVSANSFLNVRKGPGERFAVATTGNDAVPIRLPKGAVISIDAESNGWGRWTGTGYWVSLAYLKR
Other Proteins in cluster: phalp2_11769
| Total (incl. this protein): 178 | Avg length: 277,6 | Avg pI: 9,09 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7VlRi | 263 | 8,48954 |
| 13yvW | 256 | 8,19659 |
| 1khNo | 363 | 9,03784 |
| 1mgsZ | 264 | 8,88266 |
| 1oey3 | 270 | 8,94004 |
| 21lR0 | 346 | 7,97875 |
| 21xTI | 269 | 8,09331 |
| 2lUZm | 277 | 9,30061 |
| 2m9eG | 268 | 8,88318 |
| 2mBxz | 268 | 9,23782 |
| 3A5HC | 312 | 9,16362 |
| 3B2bW | 268 | 9,17948 |
| 3GMPW | 268 | 9,23782 |
| 3jRsq | 268 | 9,23782 |
| 3k4zg | 268 | 9,23782 |
| 3kQ34 | 333 | 9,04680 |
| 3kXCT | 268 | 8,94268 |
| 3kgQW | 268 | 9,01611 |
| 3kt93 | 268 | 9,23782 |
| 3oSWX | 268 | 9,23782 |
| 3pCqO | 271 | 9,31009 |
| 3pjH5 | 268 | 9,14963 |
| 3qU9v | 268 | 9,22261 |
| 3qYMq | 268 | 9,23782 |
| 3qenM | 268 | 9,23782 |
| 3qhgr | 277 | 9,09605 |
| 3rlU4 | 268 | 9,34084 |
| 3sewc | 247 | 9,62766 |
| 3tPJC | 268 | 9,23782 |
| 3tVW8 | 268 | 9,27927 |
| 3tx2o | 268 | 9,17045 |
| 3u0xA | 268 | 9,23782 |
| 3uHiU | 268 | 9,05873 |
| 3uOn6 | 268 | 9,23782 |
| 3vGD6 | 337 | 9,38577 |
| 3xWLe | 267 | 9,59278 |
| 3xrIA | 330 | 8,52893 |
| 3yoxN | 330 | 8,52893 |
| 4VIP3 | 333 | 8,95887 |
| 4y8B2 | 320 | 9,10418 |
| 4yr85 | 320 | 8,81484 |
| 5C12i | 268 | 8,56052 |
| 5HMb8 | 253 | 7,62031 |
| 5JZpS | 333 | 9,11217 |
| 5KEaX | 268 | 8,98111 |
| 5KPGu | 337 | 9,30886 |
| 5LJvn | 268 | 8,93463 |
| 5Mtj4 | 268 | 9,23782 |
| 5MyUs | 268 | 9,30029 |
| 5NjyI | 268 | 9,23782 |
| 5NlMz | 268 | 9,18463 |
| 5O8MR | 268 | 9,21287 |
| 5ODdW | 273 | 9,25116 |
| 5Oqls | 268 | 8,92689 |
| 5P3Zs | 268 | 9,29049 |
| 5Pigx | 277 | 9,18960 |
| 5Ptwv | 331 | 9,11211 |
| 5Pwzs | 268 | 9,23782 |
| 5Q4Km | 268 | 9,23782 |
| 5QDfJ | 268 | 9,23782 |
| 5QoKZ | 268 | 9,30029 |
| 5Qtto | 277 | 9,20829 |
| 5RHeN | 268 | 9,23782 |
| 5Rbcq | 268 | 9,23782 |
| 5TbJm | 268 | 9,17948 |
| 5U5mI | 337 | 9,22841 |
| 5U9Zd | 268 | 9,23782 |
| 5UHTN | 328 | 9,29887 |
| 5VW4X | 268 | 9,23782 |
| 5WFA1 | 268 | 9,23782 |
| 5WKS2 | 268 | 9,17941 |
| 5WRXy | 268 | 9,23782 |
| 5WWXv | 268 | 8,98124 |
| 5Y1dU | 214 | 9,28269 |
| 5YpTi | 268 | 9,23782 |
| 605ef | 256 | 8,99477 |
| 60cBr | 268 | 9,17039 |
| 62ZX0 | 268 | 9,23782 |
| 62hl3 | 268 | 9,23782 |
| 63JgJ | 268 | 9,14963 |
| 63ius | 283 | 9,34600 |
| 63poR | 268 | 9,23782 |
| 63qgo | 268 | 9,30029 |
| 63t5h | 268 | 9,23782 |
| 647Tc | 268 | 9,35618 |
| 64X5D | 268 | 8,94262 |
| 64ZEZ | 268 | 9,23782 |
| 65iQx | 268 | 9,10560 |
| 65llQ | 348 | 9,19488 |
| 66FQY | 268 | 9,30029 |
| 66Usa | 268 | 8,93463 |
| 66Vt5 | 268 | 9,23782 |
| 66bBS | 268 | 9,23782 |
| 66hAD | 268 | 9,23769 |
| 66ozz | 268 | 9,07123 |
| 66v5O | 216 | 9,63914 |
| 66yBg | 268 | 9,23782 |
| 68xta | 238 | 9,16046 |
| 69i9Z | 268 | 9,30029 |
| 69khp | 277 | 9,18960 |
| 6YJey | 333 | 8,86964 |
| 6ZQfH | 268 | 9,23782 |
| 6aHlY | 337 | 9,26619 |
| 6aK1a | 268 | 9,17039 |
| 6aSiQ | 268 | 9,30029 |
| 6aczv | 268 | 9,23782 |
| 6ati6 | 277 | 9,19546 |
| 6b5IK | 337 | 9,35715 |
| 6bCLD | 277 | 8,86223 |
| 6bDZs | 268 | 9,23782 |
| 6cKDl | 333 | 8,77352 |
| 6cOiU | 268 | 9,17393 |
| 6cROP | 268 | 9,23782 |
| 6caeY | 268 | 9,05338 |
| 6criZ | 268 | 9,23782 |
| 6dHnF | 268 | 9,23782 |
| 6eKFZ | 268 | 9,38745 |
| 6ep7X | 268 | 9,23782 |
| 6ex5j | 268 | 9,23782 |
| 6fCx4 | 268 | 9,23782 |
| 6fOp0 | 268 | 9,23782 |
| 6faYR | 268 | 9,34851 |
| 6fab6 | 268 | 9,30029 |
| 6fdRV | 268 | 8,93463 |
| 6glWa | 268 | 9,23782 |
| 6hOhm | 268 | 9,17967 |
| 6hhta | 268 | 9,23782 |
| 6iVAh | 268 | 9,23782 |
| 6irve | 268 | 9,07123 |
| 6kFQn | 268 | 9,23782 |
| 6mcA5 | 268 | 9,02424 |
| 6mt8z | 268 | 9,03526 |
| 6n1Ar | 268 | 9,30029 |
| 6nz7n | 268 | 9,02114 |
| 6oaPn | 277 | 9,10779 |
| 6oo2P | 268 | 8,76288 |
| 6pLXd | 271 | 9,35792 |
| 6qHzV | 268 | 9,23782 |
| 6qJfs | 365 | 8,94236 |
| 6rDRO | 268 | 9,23782 |
| 6rHkZ | 268 | 8,93334 |
| 6s4OF | 277 | 9,18960 |
| 6sFlP | 268 | 9,23782 |
| 6sadl | 268 | 9,30029 |
| 6ti23 | 277 | 9,34903 |
| 6vFJV | 268 | 9,23782 |
| 6via2 | 268 | 9,23782 |
| 6vpt3 | 299 | 9,35838 |
| 7Ni7u | 268 | 9,06795 |
| 7V4JY | 277 | 9,19546 |
| 7VmRw | 260 | 8,63201 |
| 7X7DC | 268 | 9,23782 |
| 7vj4f | 268 | 9,30029 |
| 7xBRJ | 328 | 9,36998 |
| 7xW4W | 268 | 9,30023 |
| 81PnH | 296 | 5,08757 |
| 82z7b | 331 | 8,95899 |
| 84P8w | 363 | 8,98852 |
| 84QXe | 261 | 8,17300 |
| 84mZv | 268 | 9,23782 |
| 85xz4 | 268 | 9,23782 |
| 87AEz | 297 | 5,51818 |
| 8brOY | 253 | 9,41227 |
| 8cEv6 | 268 | 9,23782 |
| 8dgKq | 268 | 9,23782 |
| 8dvpa | 268 | 9,23782 |
| 8ehMo | 268 | 9,23782 |
| 8ewWi | 268 | 9,14976 |
| 8f4uv | 268 | 9,07839 |
| 8fg6N | 363 | 8,99432 |
| 8gkcw | 268 | 9,34851 |
| 8hP6q | 268 | 9,23782 |
| 8m8Dl | 263 | 8,48238 |
| 8th1H | 268 | 9,23782 |
| CNoa | 271 | 9,17380 |
| K51t | 268 | 8,92586 |
| xi8W | 268 | 9,24755 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_14086
8rXpR
|
12 | 51,9% | 179 | 3.941E-82 |
| 2 |
phalp2_8621
23FuJ
|
3 | 41,0% | 263 | 3.591E-78 |
| 3 |
phalp2_18916
23Hlc
|
105 | 38,2% | 264 | 1.114E-55 |
| 4 |
phalp2_14958
q7W9
|
544 | 48,5% | 171 | 1.093E-52 |
| 5 |
phalp2_18083
3TFqE
|
6 | 40,9% | 183 | 3.892E-44 |
| 6 |
phalp2_15414
23rlq
|
22 | 34,2% | 175 | 2.865E-34 |
| 7 |
phalp2_20439
3nCW3
|
18 | 34,1% | 217 | 5.327E-34 |
| 8 |
phalp2_10720
3dNKh
|
35 | 28,0% | 271 | 3.562E-31 |
| 9 |
phalp2_21505
8k22n
|
3 | 32,3% | 173 | 9.432E-27 |
| 10 |
phalp2_27947
F3FN
|
52 | 33,7% | 178 | 3.229E-26 |
Domains
Domains
1
263 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7VlRi)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50