Protein
- Protein accession
- 5PfBQ [EnVhog]
- Representative
- gqNV
- Source
- EnVhog (cluster: phalp2_8339)
- Protein name
- 5PfBQ
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MSQFTVRYSLPESGNKLYNNGNAGGWSWCINGSPTKAGLNVLSNCVGWACSRFNEIYNEITGNNGMKYKTLCCNAENFIKRAKQAGLEVGMTPKPGAIMCWQKGATLSGSDGAGHVAICEIVYDNNHVFTSESGYGGSAFWNSHRYNTNGRWGLGSSYTFRGFIYNPAVKDEPTPTPTPSSKFNIGDKVVINGALYRNSNASSASGSVSNKITNITRKVSGAVHPYNTTGDLGWMDEASITKYEEPKPSTGQKFAIGTKVVINGALYRSSNDNNAAGYVNNKTTYITRYAAGSKHPYNTTGDLGWMDEGAITAYSGGITYTVKKGDTLSGIAAKYGMTWQQVYARNKFVIGNNPNIIKPGQVLVIKD
- Physico‐chemical
properties -
protein length: 367 AA molecular weight: 39631,9 Da isoelectric point: 9,28 hydropathy: -0,45
Representative Protein Details
- Accession
- gqNV
- Protein name
- gqNV
- Sequence length
- 300 AA
- Molecular weight
- 31872,34700 Da
- Isoelectric point
- 9,38990
- Sequence
-
VLKMNIRTSKPGAGNKFYITTSKGGYSRCIQGSPTDSQCNVLANCVGYACGRFNEIIGSMKYPNLNCNAENFIERAQSYGLQISPVPTLGGIMVWKKGNTLSGNDGAGHVAIVEKIIDSNTIYTSESGYGSSAFWNSTRTNNNGRWGLGSGYTFRGCIVNPAIGNVSAPTAPEVKPDPFAGVSDEELARRVWTGEFGNGQDRKNALGSRYNAVQALVDKGVGKPAPQPAAPAPSNELKAGDRVKITGTGNGSSMGNSNTAYGIGWERQILKVWDGRPFPYQVGNSTGTTGFYKASALQKM
Other Proteins in cluster: phalp2_8339
| Total (incl. this protein): 140 | Avg length: 337,1 | Avg pI: 7,76 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| gqNV | 300 | 9,38990 |
| 1G2wn | 346 | 5,03403 |
| 1GGSX | 282 | 9,15201 |
| 1GKha | 290 | 9,18315 |
| 1NypV | 282 | 9,27631 |
| 1gCx2 | 397 | 6,23793 |
| 1gxq8 | 319 | 8,92573 |
| 1khTN | 326 | 9,62063 |
| 1m8KD | 370 | 9,28237 |
| 1ob6K | 291 | 9,52870 |
| 21Gbm | 276 | 9,98978 |
| 21HP4 | 353 | 9,08967 |
| 21yFP | 392 | 5,52199 |
| 21z6h | 256 | 9,59497 |
| 23F7H | 281 | 8,83038 |
| 23McM | 256 | 9,57808 |
| 23O35 | 276 | 9,60909 |
| 23S9h | 369 | 5,68301 |
| 23eyh | 331 | 8,03851 |
| 23uPG | 286 | 9,38146 |
| 23ywr | 330 | 9,06208 |
| 24lI9 | 390 | 5,19369 |
| 2ELP | 283 | 9,37540 |
| 2o1ql | 285 | 9,43084 |
| 38GVf | 397 | 9,35438 |
| 3PLLG | 292 | 9,33639 |
| 3PLiv | 392 | 5,33897 |
| 3PYbu | 279 | 9,21803 |
| 3TEna | 328 | 8,59165 |
| 3ZIyb | 471 | 7,49015 |
| 3ZTYy | 325 | 9,81275 |
| 3ZugD | 315 | 9,60709 |
| 3c4Mc | 272 | 5,50920 |
| 3dU8Y | 303 | 6,44539 |
| 3e33K | 327 | 9,48216 |
| 3fPmh | 474 | 4,75443 |
| 3gQPd | 301 | 9,28372 |
| 3gZAG | 357 | 8,10866 |
| 3gdQn | 303 | 8,20826 |
| 3gdb6 | 304 | 8,46530 |
| 3gioC | 400 | 6,38128 |
| 3ilCy | 306 | 8,67656 |
| 3j0l5 | 305 | 8,31031 |
| 3l8e0 | 326 | 9,80256 |
| 3nPA5 | 457 | 4,69919 |
| 3ph1q | 281 | 9,29913 |
| 3tqME | 280 | 6,00802 |
| 3v88U | 286 | 9,34161 |
| 40dOF | 273 | 8,78712 |
| 41awc | 391 | 5,43502 |
| 41eki | 325 | 8,73871 |
| 45m4n | 343 | 5,08660 |
| 4MjN8 | 406 | 7,97334 |
| 4kjoG | 473 | 5,12855 |
| 4kkhn | 305 | 8,86126 |
| 4klg2 | 279 | 4,75932 |
| 4knwS | 407 | 5,95772 |
| 4kpL6 | 318 | 8,32920 |
| 4y6eh | 385 | 9,11256 |
| 4yvD6 | 280 | 9,09670 |
| 5KWne | 395 | 5,65954 |
| 5KszQ | 397 | 5,65954 |
| 5LIrb | 395 | 5,65954 |
| 5MZhF | 281 | 9,38900 |
| 5PIAv | 281 | 9,31228 |
| 5PzG9 | 326 | 9,04854 |
| 5PziK | 395 | 5,29725 |
| 5QOrb | 270 | 8,67675 |
| 5QYps | 324 | 5,39842 |
| 5RYtQ | 313 | 8,95036 |
| 5S5ec | 395 | 5,39677 |
| 5SF5G | 285 | 8,88995 |
| 5Svld | 283 | 8,88995 |
| 5TWbv | 395 | 5,83676 |
| 5TjVh | 324 | 9,48596 |
| 5U2cZ | 287 | 9,45817 |
| 5UVIR | 392 | 5,26013 |
| 5Ueff | 326 | 9,71508 |
| 5W2EK | 394 | 5,13224 |
| 5XURb | 382 | 5,62714 |
| 5XVTu | 392 | 5,25212 |
| 5XjyV | 395 | 5,54040 |
| 5YMJ3 | 395 | 5,39677 |
| 5ZUsY | 395 | 5,39677 |
| 60ldD | 325 | 9,73713 |
| 62Vro | 375 | 8,88892 |
| 62yEn | 393 | 5,21938 |
| 638Ul | 286 | 9,39699 |
| 64FFy | 412 | 5,19363 |
| 64MZr | 284 | 9,52870 |
| 65cDD | 286 | 9,45817 |
| 664XZ | 397 | 5,39677 |
| 667P | 286 | 9,18276 |
| 66bf7 | 373 | 5,49675 |
| 69b7f | 395 | 5,39677 |
| 69mBX | 325 | 9,65622 |
| 69tk9 | 395 | 5,39677 |
| 6ZLzo | 358 | 5,77231 |
| 6ZYKz | 275 | 8,95629 |
| 6aZnN | 286 | 9,45817 |
| 6azXi | 364 | 9,24278 |
| 6b1Q7 | 281 | 9,44547 |
| 6cMxq | 274 | 8,82496 |
| 6d8xx | 365 | 9,19688 |
| 6eb2L | 395 | 5,51403 |
| 6f8dj | 313 | 9,11481 |
| 6iq2x | 402 | 5,31009 |
| 6jALK | 367 | 9,28192 |
| 6jCS3 | 395 | 5,39677 |
| 6kZN8 | 281 | 9,31228 |
| 6lWsU | 329 | 9,33717 |
| 6nQ6n | 401 | 5,25740 |
| 6oPV8 | 281 | 8,65380 |
| 6om4R | 329 | 9,15859 |
| 6rTMl | 274 | 8,38626 |
| 6rTZA | 395 | 5,29202 |
| 6rcog | 406 | 5,49874 |
| 6sZUv | 370 | 9,17200 |
| 6uVyQ | 406 | 8,41443 |
| 7DGzV | 254 | 9,27650 |
| 7DSfj | 296 | 5,80897 |
| 7Jy8X | 393 | 5,31657 |
| 7V8F2 | 274 | 8,71414 |
| 7VoR4 | 367 | 9,17135 |
| 7XBJ2 | 403 | 5,25592 |
| 7Y9ec | 258 | 9,35257 |
| 86ca5 | 280 | 8,98697 |
| 8aTaV | 397 | 5,29031 |
| 8by3a | 407 | 5,40808 |
| 8idal | 281 | 9,31228 |
| 8mlK4 | 395 | 5,29207 |
| 8mn8a | 326 | 9,48467 |
| 8mpb1 | 280 | 9,18850 |
| 8pXue | 295 | 8,94391 |
| 8qR5u | 280 | 8,99561 |
| 8rY35 | 327 | 9,59420 |
| 8sDU0 | 395 | 5,12673 |
| a4sZ | 274 | 9,58885 |
| wYbB | 312 | 5,46657 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_17558
5WoZV
|
75 | 45,6% | 313 | 5.130E-94 |
| 2 |
phalp2_21652
2Vk4c
|
5 | 60,9% | 243 | 8.713E-90 |
| 3 |
phalp2_35624
1krKO
|
8 | 45,5% | 215 | 4.541E-58 |
| 4 |
phalp2_18807
1gBg7
|
77 | 37,3% | 222 | 1.032E-56 |
| 5 |
phalp2_34257
3cuKR
|
1 | 33,0% | 227 | 1.195E-42 |
| 6 |
phalp2_36926
5qMz
|
3 | 30,4% | 207 | 1.388E-32 |
| 7 |
phalp2_20197
8bszo
|
7 | 28,4% | 218 | 7.939E-24 |
| 8 |
phalp2_25206
24Le0
|
10 | 29,0% | 220 | 2.668E-23 |
| 9 |
phalp2_19753
7DRZn
|
3 | 24,5% | 297 | 5.022E-20 |
| 10 |
phalp2_12720
41oqI
|
16 | 26,0% | 192 | 7.929E-14 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(gqNV)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50