Protein
- Protein accession
- 5Ow8N [EnVhog]
- Representative
- 6pAzH
- Source
- EnVhog (cluster: phalp2_33315)
- Protein name
- 5Ow8N
- Lysin probability
- 96%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MCGKHLAKRKKNHAPLVAVLAICAIVAVITEVISCSQDAKAYEFYNSYSYPVTTSYVTPSKEIVVDNTEEFDVKAEDIEYVDVEFADLVINEPEAVVKSEPSYSEEDLDLLARLMTAEMGSEWVPDEVQLYVGSVPLNRMKSDAFPGETLYDVVYQEGQYSPTWTGAINNTPDERTIENAKKLLTEGSVLPENVVFQANFKQGDGVYYEYYDEILGTTTYFCYLGNS
- Physico‐chemical
properties -
protein length: 227 AA molecular weight: 25450,2 Da isoelectric point: 4,26 hydropathy: -0,24
Representative Protein Details
- Accession
- 6pAzH
- Protein name
- 6pAzH
- Sequence length
- 205 AA
- Molecular weight
- 23061,65110 Da
- Isoelectric point
- 4,48610
- Sequence
-
MSKIKEQVIAIVIILSVIGTSVYTHINLNRKVPIEEIACIGKITPPEVNTEGLITVEMVDTTVEQQEDQKEEVAPVQNVVVEETSTNTNYTEDDLYWLSKAIAQELGSYWVPDWAQQWVASVVLNRVNHPSFPDTIYGVLHQPGQYCGFYATPTEQNVANARYVLENGSVLPENVVFQSLCTQGSGIHGTYYDPYMNNTTYFCYK
Other Proteins in cluster: phalp2_33315
| Total (incl. this protein): 114 | Avg length: 206,0 | Avg pI: 4,97 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 6pAzH | 205 | 4,48610 |
| 199F8 | 174 | 4,70032 |
| 19cJa | 219 | 4,41823 |
| 19cUT | 206 | 4,62768 |
| 19iUI | 155 | 4,24976 |
| 1FYkw | 187 | 4,09362 |
| 1JgHL | 197 | 4,28381 |
| 1dfeg | 194 | 4,42920 |
| 1oDez | 210 | 4,70550 |
| 1zJ34 | 196 | 6,73379 |
| 2HA9Z | 187 | 5,51119 |
| 2LD1Z | 187 | 4,66139 |
| 2o4fe | 229 | 5,63089 |
| 2o6yb | 207 | 4,05003 |
| 3PZ72 | 245 | 4,47683 |
| 3Q2mX | 210 | 4,19213 |
| 3TIvQ | 183 | 4,34531 |
| 3WNqx | 191 | 4,22276 |
| 3ZPCa | 174 | 6,96342 |
| 3d7Vd | 209 | 5,21943 |
| 3dUE2 | 167 | 7,16958 |
| 3dYMW | 184 | 6,07424 |
| 3ejLN | 195 | 5,46475 |
| 3esfg | 210 | 4,61205 |
| 3fLir | 172 | 7,00412 |
| 3gIct | 177 | 7,87838 |
| 3gLk0 | 204 | 8,56993 |
| 3gcTs | 205 | 8,57167 |
| 3iWrN | 177 | 4,84805 |
| 3iXmA | 183 | 6,43289 |
| 3iset | 175 | 5,38063 |
| 3isqi | 175 | 6,17473 |
| 3mguZ | 213 | 4,20696 |
| 3rfr4 | 228 | 4,18474 |
| 3sf1R | 228 | 4,17127 |
| 3tk19 | 216 | 4,11863 |
| 408oF | 184 | 5,65391 |
| 40ckL | 211 | 8,74960 |
| 40n4p | 173 | 8,30877 |
| 41ftb | 180 | 4,20719 |
| 441N1 | 185 | 9,64320 |
| 45sbf | 202 | 4,48962 |
| 4L3pb | 174 | 4,28358 |
| 4k4xP | 211 | 7,05636 |
| 4k8jM | 179 | 6,05758 |
| 4klE1 | 177 | 7,66487 |
| 5Ki3Z | 211 | 4,52560 |
| 5LWrW | 182 | 4,84282 |
| 5OEES | 228 | 4,17053 |
| 5QEgL | 228 | 4,18474 |
| 5QakY | 216 | 4,54117 |
| 5Qx4W | 211 | 4,39106 |
| 5RGyn | 227 | 4,24413 |
| 5RYpq | 228 | 4,17053 |
| 5RwKy | 211 | 4,50474 |
| 5SWDE | 214 | 4,07822 |
| 5TVjE | 211 | 4,33786 |
| 5TmnF | 228 | 4,18474 |
| 5UZTh | 211 | 4,64644 |
| 5UtEy | 211 | 4,49184 |
| 5Vgj9 | 211 | 4,49184 |
| 5WHCd | 205 | 4,54743 |
| 5YQQF | 212 | 4,05003 |
| 61uuw | 219 | 4,23885 |
| 62Ieb | 216 | 4,46080 |
| 63GoO | 219 | 4,60483 |
| 6531z | 216 | 4,54117 |
| 65WDZ | 228 | 4,21384 |
| 6721G | 211 | 4,21174 |
| 67jeD | 228 | 4,17127 |
| 67pOK | 205 | 4,53168 |
| 69Dtw | 211 | 4,38958 |
| 6UH7D | 189 | 5,08160 |
| 6bf7F | 228 | 4,20247 |
| 6cjx5 | 211 | 4,41590 |
| 6dZoa | 214 | 4,15052 |
| 6iP0H | 219 | 4,13262 |
| 6iuuL | 211 | 4,23186 |
| 6jPkb | 205 | 4,43182 |
| 6l2KR | 212 | 4,09499 |
| 6l2Kx | 212 | 4,07822 |
| 6lSE0 | 234 | 4,66179 |
| 6mDmt | 224 | 4,70311 |
| 6mIaH | 227 | 4,78257 |
| 6mS7f | 163 | 4,05003 |
| 6pZws | 211 | 4,36747 |
| 6rfR0 | 225 | 5,10439 |
| 6tmKK | 211 | 4,43250 |
| 6w6UX | 216 | 4,43250 |
| 6w70Z | 211 | 4,39106 |
| 71hKT | 180 | 6,20366 |
| 71jee | 201 | 7,64805 |
| 7DSx5 | 183 | 8,86983 |
| 7G6Dy | 206 | 4,65877 |
| 7XSIH | 228 | 4,18474 |
| 87S8L | 219 | 4,18519 |
| 87oqC | 228 | 4,23282 |
| 8aWMO | 204 | 4,05003 |
| 8f4tA | 247 | 4,51599 |
| 8f77f | 219 | 4,23703 |
| 8kQ0N | 228 | 4,18474 |
| 8lGyv | 239 | 4,76341 |
| 8lbf1 | 211 | 4,32729 |
| 8oWla | 176 | 4,72010 |
| 8rHtj | 239 | 4,45688 |
| 8shmH | 209 | 4,14563 |
| Z50Z | 195 | 4,98696 |
| ZpEP | 187 | 5,20358 |
| ZzrX | 195 | 5,11292 |
| g3H2 | 204 | 4,74466 |
| o5wn | 239 | 4,20133 |
| orli | 233 | 4,47530 |
| qdM0 | 219 | 4,23794 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_24264
38Ozb
|
91 | 34,2% | 207 | 4.905E-43 |
| 2 |
phalp2_29624
8595R
|
1 | 38,7% | 147 | 1.384E-37 |
| 3 |
phalp2_12002
7DLNP
|
3 | 32,9% | 191 | 1.866E-34 |
| 4 |
phalp2_5441
2VclY
|
37 | 37,4% | 131 | 3.490E-34 |
| 5 |
phalp2_27258
45BT1
|
80 | 29,9% | 177 | 5.838E-33 |
| 6 |
phalp2_22617
1Nzzh
|
32 | 42,5% | 134 | 2.407E-28 |
| 7 |
phalp2_3305
2VdfI
|
36 | 40,8% | 142 | 4.831E-26 |
| 8 |
phalp2_3197
7nFFO
|
87 | 33,3% | 123 | 2.293E-25 |
| 9 |
phalp2_6757
41bxG
|
1 | 26,3% | 152 | 2.440E-23 |
| 10 |
phalp2_18913
23yi7
|
11 | 31,8% | 132 | 1.711E-18 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(6pAzH)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50