Protein

Protein accession
5GBQn [EnVhog]
Representative
4UNXW
Source
EnVhog (cluster: phalp2_34559)
Protein name
5GBQn
Lysin probability
63%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MSEVVKCIDISHWQNFPNFTEVRAAGVIAMIHKATEGSSYVDPNRAKNISNAIKAGIKCCTYHWIKPGNASNQMDFYLKTIDPVPGERVVIDYEEDGCSLDDLHEAVQTLLDDPRGLQITVYSGHLLKEQLSSHDELLAKNTDLWLAQYTSGTPTWSTETYSHWALWQYSESGTVNGIDGSLVDLNRFDGTDDELLAWISPAGSVKPPKPKPVPAQIDITVIGDVTISINGKVVT
Physico‐chemical
properties
protein length:235 AA
molecular weight:25917,8 Da
isoelectric point:4,81
hydropathy:-0,27
Representative Protein Details
Accession
4UNXW
Protein name
4UNXW
Sequence length
211 AA
Molecular weight
23615,21520 Da
Isoelectric point
6,23077
Sequence
MTPLLNVVIDISHHNTTTSFKDAFDSGIMGVIHKATEGTSFVDAKYRDRRHRAVAAGLLYGAYHFGVKGNPREQADHFLETADPGDLMVLDFEPNPREGTMSVSEAEEFMAHVVANTGRRPWLYSGQSFLKDQLRRRPDSNLFLSPLWIARYSQRMPEVPVGFATFTLWQYTDGSMGPQPHQVPGIGRCDRNKFNGTEAELRALWGGDSGN
Other Proteins in cluster: phalp2_34559
Total (incl. this protein): 287 Avg length: 232,7 Avg pI: 5,57

Protein ID Length (AA) pI
4UNXW 211 6,23077
11FxU 223 5,40416
14GoZ 225 5,66579
15Ftt 235 5,24746
15G1f 219 5,51198
15Gay 257 4,31444
15Hob 250 4,98162
15Ir1 235 4,74585
16HN5 163 4,79604
16bbm 188 5,12605
16d3h 240 5,47436
16gtL 237 6,05696
16iwz 258 4,72505
16j3z 245 4,61381
1FSYp 268 4,73249
1IgCM 244 5,22552
1IkYF 232 5,86785
1ItQk 233 4,83338
1NEOw 231 5,41246
1XLjq 212 5,61293
1b76Q 290 4,32263
1bmG4 270 9,19824
1dXp0 259 5,10286
1dw4x 234 5,67295
1eWev 233 5,48396
1fPtq 197 8,04715
1fXLJ 241 4,35775
1fv6t 231 5,25911
1gobB 293 6,05633
1gv1e 243 5,68267
1idz7 208 5,87087
1ifB5 167 5,56916
1nDNe 240 6,03689
1oJSv 291 5,82750
1omy0 232 4,20361
1ooXq 239 4,93621
1oweq 285 7,83544
1owjQ 196 5,91503
1p7eH 238 4,44932
1p8Js 235 5,47799
1pJ0I 237 4,75915
1pKmR 244 6,50991
1pOH6 237 4,75915
1pa9M 255 4,58284
24NIt 199 4,30705
2545j 233 4,05003
257vr 237 4,31274
2586G 237 4,49724
2597S 242 4,49565
25k1d 234 4,74972
2DQxw 195 5,18101
2Di3J 232 6,42738
2Dw1Z 195 5,46623
2SErh 236 5,29412
2TiAr 217 5,10632
2bcVA 209 9,55210
2n0I1 205 6,05235
350H4 200 5,16277
367Mi 227 5,39114
3BjfF 195 4,65400
3LBIc 234 4,84145
3SRJG 239 5,53466
3SSPP 198 5,21546
3T0li 200 4,80144
3Tbx9 238 4,35775
3V2xx 208 6,24401
3V3mN 221 5,10615
3X1lL 204 4,59688
3X9h1 231 5,93066
3XidO 299 6,95115
3XjT6 230 5,25098
3XjZR 252 4,99799
3d19l 210 7,21136
3d1Y2 289 6,36298
3fYsV 235 5,53654
3g4Yg 198 5,37045
3zYUH 235 4,94973
42v2V 303 8,85952
44LRO 195 5,17578
44Lqw 209 4,70146
452Fn 245 5,04585
45Eqh 222 5,18237
4AiXf 244 4,52333
4CNxa 302 7,10484
4DYmM 222 5,86370
4E0P1 227 6,22168
4E0XT 230 5,87717
4E7MM 161 6,34485
4E9yx 201 5,39166
4EFQE 266 4,38345
4EGdx 234 4,52503
4EIoa 214 4,15279
4EMnW 205 7,20368
4ENkC 260 4,57533
4EOyj 242 4,37623
4EP4h 216 5,18812
4EPk3 254 4,39930
4ERPa 237 4,65326
4ESRx 195 6,01893
4Eddm 218 5,29560
4Efkp 258 4,38197
4EfuJ 258 4,49542
4Eg7D 258 4,48195
4EkoR 241 7,80095
4El7j 194 5,24450
4Elvr 217 4,69816
4EmSv 211 5,05068
4Enbr 210 6,30659
4F0JL 239 4,54561
4F250 235 4,25385
4F7Vw 210 5,83335
4FddG 251 4,40101
4HMFH 242 4,72840
4I68V 243 4,65002
4IbNE 189 5,58707
4IdWC 217 5,21528
4IgG0 259 4,73073
4Imi5 247 5,41678
4IuYN 268 5,30697
4JX8O 228 5,32112
4Jjn0 222 9,11249
4K1e3 254 4,74955
4K2GO 259 5,10939
4KRnO 217 5,06119
4KUye 242 5,45838
4LKYK 230 5,54080
4Mb8b 246 4,51787
4Mz58 217 9,13345
4SRMc 205 4,92984
4T2Re 212 5,03414
4T6RK 273 5,08990
4U3Er 256 5,05341
4W1WR 230 5,87467
4dAGk 230 4,89710
4fAUE 278 4,97179
4fqK1 234 8,70247
4g49W 208 5,67108
4gPGS 209 9,81069
4gwqN 280 5,31850
4jjDZ 239 5,02885
4ktAz 273 5,88957
4kuLF 242 5,82949
4lYA0 226 5,51079
5Asdz 233 5,06875
5B2q5 270 6,20099
5B33f 276 9,00071
5BDqQ 262 9,34026
5BYpi 209 7,01947
5BqhP 230 5,15390
5F03U 237 5,67892
5F549 201 6,15552
5F5Vc 234 4,72067
5F5W8 234 5,87416
5F6Xr 240 5,08552
5F8bi 231 5,25621
5F8dv 249 4,96809
5Fren 240 5,41286
5GBCt 255 5,36687
5GCQW 231 5,39359
5GMZ4 241 7,05403
5GTAS 215 5,74895
5GXh9 250 4,79331
5H3fE 217 4,80638
5IIJP 249 4,77831
5IJSr 185 4,82878
5IZA3 257 4,96536
5J0Yf 251 5,03834
5J67J 229 4,40419
5Jfxv 242 4,43540
5Jvtm 241 4,41545
5JxAM 257 4,78803
5feYW 260 9,08155
5hYbc 285 5,52216
5l2bU 246 7,14241
5nEU6 236 5,60077
5nIIW 280 4,87397
5nOzE 231 5,72081
5ofcj 247 4,89346
5okDu 196 4,65741
5ori3 200 6,50076
6AjgE 207 6,39805
6CBFS 237 5,42837
6CLdj 258 5,62293
6CcNr 244 4,16115
6CcVM 234 4,52560
6DVWJ 241 4,91711
6EBHG 278 5,89946
6EwXh 235 6,02626
6F0SE 237 4,52804
6FhTN 234 5,58883
6HUMv 258 6,40623
6HUPP 231 5,60463
6HUfs 232 4,55385
6HWV7 230 6,27141
6HYmw 203 5,18095
6HcNX 236 5,70177
6HcaL 227 4,67827
6HzPo 272 5,16186
6I0f1 212 5,19374
6I19p 231 6,40373
6I2qN 241 4,82690
6I46x 246 4,50531
6I4t7 231 5,82267
6I75E 199 4,99327
6I92J 204 5,54484
6IN35 236 5,24319
6Ie3C 200 5,56689
6IqMe 227 5,54393
6K82u 245 4,57414
6KNf5 327 5,21415
6KfTD 248 5,01464
6Kfxk 232 4,63280
6KhjR 234 5,77896
6Ko6o 211 4,92455
6LfcE 205 6,29392
6Ljvs 231 5,27099
6Lk7q 210 9,62212
6NtuW 225 5,30498
6RvOC 201 5,76156
6U9Uj 234 4,29614
6V0YI 240 4,86476
6WCMZ 244 4,93268
6Wj3Y 222 7,88360
6XDnc 227 6,02820
6XHDK 218 5,51983
6XHxV 203 5,37620
6XHxo 231 5,27116
6XKpH 237 4,40237
6XMAh 223 4,99907
6XQIH 231 6,50030
6XTt6 221 4,78291
6XUPs 239 4,52134
6XXcl 231 6,06241
6XYoa 211 4,89710
6XYzM 262 4,37896
6Xt3t 227 5,56672
6XzeU 231 5,74673
6Y0TT 231 5,21995
6Y1fV 213 5,30464
71YUX 258 4,43767
72cxl 231 5,04681
759mN 234 8,33191
7ZYI6 231 8,44615
7hJsD 262 4,62734
7pt2q 274 7,83647
7r05p 175 9,39171
7sJ45 234 5,53040
7sJ4H 234 8,82883
7woE3 230 5,33510
7woR5 234 5,45355
7wopK 232 5,13742
7woqv 207 8,76340
7xkPm 277 4,67332
7yPXT 282 5,73650
7z0Of 259 4,39521
7zlm3 242 4,42386
7zm6G 212 6,58579
86EtX 209 9,44999
86ICr 219 4,71686
86XUr 218 4,79485
873eK 217 5,05142
8EDN 226 4,77285
8aJWC 233 6,06992
8aMga 216 10,06592
8aOlQ 209 6,34388
8i6pc 171 5,10883
8iRVz 211 10,90156
PY4p 228 5,57098
QQz2 214 5,75480
SkOO 254 4,31439
SmIf 241 4,70260
Th83 236 5,07336
efeo 223 5,76048
gC6V 235 5,47799
gY4J 208 5,14907
geB9 245 5,68682
h19Y 233 4,91262
hE2E 236 5,78726
hna1 226 6,58437
jrlW 211 6,34234
kR03 234 5,67585
l2CH 229 6,57163
l2zH 237 4,27272
ly79 209 5,21727
mmO0 195 5,46623
nC3t 245 4,35184
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_25768
4SYdg
4 39,1% 212 5.294E-63
2 phalp2_32516
1lx3B
3 42,5% 207 5.294E-63
3 phalp2_39912
1jXPT
300 40,7% 201 3.927E-60
4 phalp2_5615
4g2xP
40 34,9% 206 4.457E-55
5 phalp2_10644
2AeOK
60 36,0% 194 1.752E-52
6 phalp2_24797
6XSuF
8 33,1% 220 2.399E-52
7 phalp2_6842
8jh1R
119 36,0% 219 7.616E-51
8 phalp2_20360
2RVWF
69 41,3% 196 5.019E-50
9 phalp2_35314
79Mal
26 33,3% 216 7.653E-48
10 phalp2_5981
6El6s
21 27,3% 212 2.182E-45

Domains

Domains
Representative sequence (used for alignment): 4UNXW (211 AA)
Member sequence: 5GBQn (235 AA)
1 211 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01183

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4UNXW) rather than this protein.
PDB ID
4UNXW
Method AlphaFoldv2
Resolution 95.45
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50