Protein

Protein accession
5E6aI [EnVhog]
Representative
61fFV
Source
EnVhog (cluster: phalp2_13677)
Protein name
5E6aI
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MNKTLLILAAVTVSRYAPCPAITPAELDRLIPALIQVESGGEYRAVGDHGKAVGILQIHAEYVQDVNRIAGTHYTLRDRLDRQKSIDMTRIYLAHYGKGKTIEQTARVHNGGPAGHKKQSTVKYWNKVRKELK
Physico‐chemical
properties
protein length:133 AA
molecular weight:14860,0 Da
isoelectric point:9,81
hydropathy:-0,43
Representative Protein Details
Accession
61fFV
Protein name
61fFV
Sequence length
145 AA
Molecular weight
16787,31740 Da
Isoelectric point
9,69819
Sequence
MAKVKQIIFIVFLLLSFNINAQSKKDFNWTNVIEAIAQVESKGDSTAVSKCQHVGYLQISPIMVKDCNRILKYNKYTLKDRYSKQKSIEIFYLIQSYYNKTNNIEKAIRLWNGGTGYTIKGTNGYYQKVMKEYSKILSEVKNGKT
Other Proteins in cluster: phalp2_13677
Total (incl. this protein): 187 Avg length: 146,6 Avg pI: 8,74

Protein ID Length (AA) pI
61fFV 145 9,69819
17jgY 167 5,34050
19hZR 166 9,96038
1EfTw 152 9,06421
1SLrG 183 6,73328
1cB74 142 9,79425
1cBxe 155 9,98604
1cLTc 141 9,94749
1cM4s 142 9,66563
1erfh 140 10,13902
1gGAf 145 9,00773
1gOfY 124 6,58908
1kZqs 155 9,39609
1kvPH 145 10,01647
1l2Ai 138 9,97817
1lBoB 158 6,73755
1nw6W 142 9,76717
1obp0 142 4,90648
1rQcJ 173 7,63833
1ryj6 132 9,86516
21uOe 131 9,53979
235M3 162 8,63498
23GzR 144 9,90732
26Fap 177 5,92844
26t9O 133 9,49002
2F2B 138 9,77826
2I3Ga 132 10,00177
2JmK1 133 9,46597
2MVhB 132 9,95290
2eQCV 177 5,53978
2w9yc 173 7,59525
38LuA 132 9,28533
38OA3 122 7,83673
3AXcY 150 9,58569
3BA9q 174 5,65613
3IESJ 173 7,63833
3QqkI 162 5,63464
3RzdB 148 9,58408
3S3gQ 157 9,58859
3ZA6R 132 9,31563
3ZKwg 127 9,93930
3ZZvJ 128 9,85143
3ZrAd 131 9,59917
3dXnK 155 9,62889
3e1su 156 9,82171
3e2o2 143 9,51349
3fKdm 121 9,32943
3g9gH 134 9,42284
3gUvL 186 5,63527
3gcWn 130 9,61038
3gfSA 130 9,80231
3h2U5 144 9,41820
3iC9r 164 6,08384
3iE0v 153 9,55733
3idB3 144 9,75808
3idHX 136 7,62844
3igZa 145 9,55107
3inM6 131 9,91861
3kQZV 148 9,13596
3oNyS 174 5,25644
3xQyS 145 4,44529
3zIvV 142 9,48912
40Ehx 141 9,21764
40X0B 143 9,32002
41n8m 124 8,83883
41pYY 145 10,01441
4BoxJ 162 8,57902
4DqmS 155 10,01756
4HahB 157 9,32743
4HjI2 141 8,92515
4HmuM 144 9,65706
4Hnae 156 9,23344
4L9BU 148 9,75434
4L9XC 132 9,82655
4Le2S 143 9,76943
4StOn 145 4,59006
4ip4B 147 10,16745
5MJXO 168 9,53347
5MNYz 148 9,15582
5Ol9h 142 5,01902
5Oq0R 136 10,00190
5P5wQ 136 10,00280
5PcIT 146 10,00177
5QHwt 139 10,08526
5QQ4b 143 5,11150
5QleZ 142 9,39003
5R7YQ 141 9,91809
5RMSC 148 9,17645
5TUFA 148 9,30087
5TyRQ 146 10,04206
5UGYw 168 9,65790
5W99K 163 6,12113
5XL6O 142 4,90648
5YIZf 141 9,89282
5Yby7 148 8,98091
5YqgT 148 5,77941
5jEBO 134 7,00782
5jRJ 143 9,77233
5tcyL 135 9,78896
6015X 148 9,15582
604Hr 142 9,38997
60VFq 141 9,72952
61jVd 139 10,08526
623Xp 129 7,96167
62SVI 143 5,26087
653i0 168 9,68723
65yh7 146 9,89656
66ps5 141 9,84292
677dB 134 9,46584
68cGC 148 9,15582
68h4 134 10,03117
68i2W 146 9,84234
6AnfS 158 9,60239
6JnWJ 132 9,91738
6LiUc 143 9,89192
6Lj6R 149 9,37939
6YXOl 141 9,71553
6Ym7x 141 9,96161
6b3GS 144 9,57357
6bave 140 8,68861
6blbp 148 9,17664
6cIVm 136 9,83202
6cg2Q 148 9,34638
6dXg6 141 9,73442
6dtIh 142 9,91783
6dxYd 136 9,96161
6eE8F 146 9,89656
6eZiR 141 9,72900
6g1qK 150 5,32248
6gBjO 148 8,96157
6h5EZ 143 5,74241
6hmSp 142 5,28792
6hoMo 168 9,59710
6hsTd 146 10,00177
6jWLK 168 9,59710
6jf8f 141 9,75634
6kGKs 146 9,84234
6ld0Y 142 4,82133
6lmaz 168 9,68749
6lx2a 148 9,17664
6mXzS 146 9,77781
6oT11 148 8,98162
6rArP 136 9,31744
6rIQM 136 9,96161
6rSWY 141 9,78954
6sFsS 150 9,39712
7DEQ6 144 9,62231
7DJdO 171 6,54554
7DQtI 132 8,61267
7EejQ 183 6,90130
7IFYw 137 5,70308
7JByH 149 9,77916
7JIt1 143 9,70870
7JzkS 155 9,70831
7Kn1s 140 5,40626
7Ncn2 168 9,65764
7OSp8 149 10,18718
7Xweq 144 5,12855
7juao 157 4,47689
84SJG 151 9,78412
84i55 140 9,79283
85xBj 133 9,25742
87xvZ 148 6,75602
8859l 147 9,94710
887xR 164 5,73599
8BrHx 119 9,46662
8F4ZJ 173 8,98343
8aQtC 121 9,61303
8d4o8 119 9,46662
8dVeE 149 9,20823
8dwOA 147 9,42201
8fve1 150 5,30088
8k6Bm 183 6,16495
8lvGX 99 9,60658
8m8Ur 151 9,83602
8nDGQ 140 9,73655
8pGhe 148 9,07749
8pUFF 137 9,86858
8pu7n 163 6,29386
8qtwj 163 6,29386
8uQrb 174 5,94743
Emii 177 5,92844
HGra 144 9,87528
JXFw 149 10,28401
rNEA 132 9,74893
A0A8S5RZ51 157 9,60207
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_32105
6iaas
89 58,4% 106 1.700E-45
2 phalp2_23582
1f8D
174 46,6% 105 2.651E-43
3 phalp2_46
7Exor
250 43,8% 114 1.761E-42
4 phalp2_20516
4eE8g
949 42,2% 135 5.159E-40
5 phalp2_11808
8aeor
7 45,2% 106 4.413E-35
6 phalp2_2751
7yxpI
42 35,0% 114 1.558E-34
7 phalp2_1136
5D1s
18 35,2% 119 4.131E-31
8 phalp2_5196
3O9Fp
630 31,4% 143 5.662E-31
9 phalp2_3524
4udWf
232 37,1% 132 4.239E-28
10 phalp2_30955
17rkV
8 30,5% 118 1.356E-26

Domains

Domains
Representative sequence (used for alignment): 61fFV (145 AA)
Member sequence: 5E6aI (133 AA)
1 145 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01464

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (61fFV) rather than this protein.
PDB ID
61fFV
Method AlphaFoldv2
Resolution 91.68
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50