Protein
- Protein accession
- 5AEeh [EnVhog]
- Representative
- 1Qasw
- Source
- EnVhog (cluster: phalp2_20092)
- Protein name
- 5AEeh
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MISILDVVKNYKGLPHQNEALRALEDTLGPYFLADDQKWVKLWRTPQRVKEAPIKGDQKFENSWSGIKACAAKAGAKFPEVVAAQWALESARGTILSGRNNFFGIKGPGTIKTTWEDYGKGAVIIKASFMDFATPFDCVNHLVTQWYKDYKGYKGVNRAKTREECAILLKREGYATDPAYSQKLIKIMNDNA
- Physico‐chemical
properties -
protein length: 192 AA molecular weight: 21583,5 Da isoelectric point: 9,32 hydropathy: -0,43
Representative Protein Details
- Accession
- 1Qasw
- Protein name
- 1Qasw
- Sequence length
- 197 AA
- Molecular weight
- 22604,33920 Da
- Isoelectric point
- 9,06401
- Sequence
-
MTIHDGLITPQKWRDCWRWFRGENHQQEAINLLYEHIKATDPALLHQSAEWLQLFTAKQLAEHEYPNSWEGVKAAAAAYGARFPQVVAAQWALESNYGAYPSGRWNMFGLKGPGTPKKTQEVYDGKAVQITASFMDFTSLGHAVRYLCDRWYKDYKGFRGVNRATSAEECARLLQSEGYATDPLYSKKLITILRRRP
Other Proteins in cluster: phalp2_20092
| Total (incl. this protein): 159 | Avg length: 188,6 | Avg pI: 7,49 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1Qasw | 197 | 9,06401 |
| 13LgE | 193 | 8,34197 |
| 155pU | 205 | 8,88447 |
| 156z6 | 375 | 7,64794 |
| 15cYR | 188 | 6,83451 |
| 15d19 | 188 | 6,43596 |
| 15dpH | 189 | 7,66647 |
| 15m2j | 187 | 7,67198 |
| 165aA | 193 | 8,76533 |
| 165g1 | 189 | 5,96107 |
| 16SyR | 189 | 6,15245 |
| 16oBf | 189 | 6,73738 |
| 16pEs | 187 | 9,17812 |
| 16pdU | 189 | 5,96113 |
| 1F1YA | 189 | 6,90721 |
| 1NwZh | 184 | 8,38226 |
| 1Phjm | 197 | 8,62466 |
| 1TaTr | 209 | 4,72744 |
| 1YK4 | 189 | 9,44721 |
| 1ebtS | 187 | 6,74374 |
| 1pEYE | 187 | 7,68670 |
| 1wYI | 184 | 6,59835 |
| 22cFL | 189 | 5,01339 |
| 24hVM | 189 | 7,62412 |
| 24t1V | 184 | 9,28424 |
| 26WEK | 189 | 5,95521 |
| 273cd | 189 | 5,60384 |
| 27WVq | 187 | 6,84025 |
| 27nwv | 133 | 6,73124 |
| 29AFD | 177 | 6,48558 |
| 29Hcu | 189 | 6,83423 |
| 29Pux | 191 | 6,10931 |
| 29R2Y | 191 | 6,83440 |
| 29TE0 | 187 | 7,70176 |
| 29VxM | 187 | 7,71182 |
| 2IDhN | 187 | 7,69750 |
| 2Ihcf | 187 | 7,70665 |
| 2IpbU | 187 | 7,67562 |
| 2IuOz | 187 | 7,70176 |
| 2J9mf | 187 | 6,83792 |
| 2JJlW | 188 | 6,83855 |
| 2K87W | 189 | 6,73567 |
| 2Kzxk | 191 | 6,31739 |
| 2M1Kx | 189 | 6,82707 |
| 2N4O | 168 | 6,49047 |
| 2OWP7 | 196 | 7,70051 |
| 2PMWJ | 188 | 8,61647 |
| 2Pu4E | 191 | 6,83554 |
| 2Qnne | 187 | 7,70597 |
| 2Uujd | 190 | 7,67010 |
| 2WAoG | 203 | 8,34397 |
| 2XhMj | 195 | 5,85711 |
| 2ZQ9g | 193 | 8,87390 |
| 2a5Tc | 188 | 5,95845 |
| 2s5XC | 209 | 4,65406 |
| 2uSjW | 184 | 7,66374 |
| 31FTM | 150 | 5,45560 |
| 32a48 | 188 | 7,69153 |
| 33vGT | 193 | 9,02050 |
| 3YsQC | 375 | 8,13780 |
| 3Z7c7 | 189 | 6,73624 |
| 3ZjCt | 215 | 5,40132 |
| 3jy4c | 184 | 9,28424 |
| 46OyJ | 136 | 8,96912 |
| 46Qb6 | 193 | 9,02050 |
| 46S0s | 194 | 9,28572 |
| 46m7y | 193 | 9,00702 |
| 47Jo3 | 137 | 9,18521 |
| 48HS4 | 136 | 8,95390 |
| 48i6E | 192 | 9,24962 |
| 49fRx | 189 | 9,33530 |
| 4BUp8 | 187 | 8,38419 |
| 4CeVB | 190 | 8,37233 |
| 4DEFH | 188 | 7,66988 |
| 4NZVQ | 188 | 7,69653 |
| 4O3ES | 188 | 7,66453 |
| 4O3L7 | 192 | 9,30035 |
| 4XYfq | 191 | 9,14898 |
| 4Xc5S | 189 | 6,61580 |
| 4ZXtB | 190 | 8,68126 |
| 4lg7r | 188 | 7,71734 |
| 4mN7I | 135 | 7,98668 |
| 4sChP | 193 | 8,39432 |
| 4sJLh | 188 | 6,83809 |
| 4sMbS | 182 | 6,37673 |
| 4sO36 | 188 | 6,83690 |
| 4sRZX | 150 | 7,90352 |
| 4sTMz | 187 | 5,83301 |
| 4sgmr | 186 | 6,43528 |
| 4ts49 | 189 | 6,90050 |
| 4wkE7 | 188 | 7,69653 |
| 4x4X6 | 184 | 7,66243 |
| 4x4pc | 187 | 5,56018 |
| 4zSPL | 192 | 9,28585 |
| 52OaQ | 125 | 9,44238 |
| 55ZN9 | 197 | 8,61241 |
| 564bp | 376 | 8,11433 |
| 59SZP | 131 | 9,03984 |
| 5ADtj | 189 | 8,39438 |
| 5BXLv | 193 | 8,97827 |
| 5DzNi | 98 | 9,33530 |
| 5Hv41 | 194 | 9,31596 |
| 5aUfB | 187 | 8,40154 |
| 5aUrq | 190 | 8,37233 |
| 5aWJm | 188 | 6,16830 |
| 5cPPL | 113 | 9,69535 |
| 5d4Aa | 137 | 7,85575 |
| 5hk4d | 192 | 9,21938 |
| 5iVoE | 188 | 7,65936 |
| 5jFtE | 188 | 8,39264 |
| 5lgzD | 241 | 5,17300 |
| 5lsIw | 197 | 8,62253 |
| 5meoz | 190 | 8,37233 |
| 5mmKX | 196 | 6,31165 |
| 5tbMo | 189 | 6,73937 |
| 5tbyz | 189 | 6,16313 |
| 5uyk9 | 125 | 9,44238 |
| 5zq2l | 188 | 7,69193 |
| 6CXmK | 184 | 6,59579 |
| 6IB2w | 195 | 5,97187 |
| 6IKRg | 136 | 8,74180 |
| 6IviY | 188 | 6,60449 |
| 6Iw8u | 136 | 9,11365 |
| 6IwMk | 187 | 6,83934 |
| 6Kd3m | 192 | 6,31631 |
| 6L7pn | 187 | 7,71228 |
| 6LCgi | 199 | 5,45469 |
| 6LmcF | 145 | 6,79467 |
| 6Lr0W | 187 | 6,83230 |
| 6MELw | 145 | 6,79552 |
| 6MHKM | 189 | 5,95828 |
| 6MfNn | 188 | 7,66453 |
| 6MuGO | 188 | 7,73104 |
| 6MxbA | 187 | 8,38419 |
| 6PcpV | 190 | 4,88158 |
| 6SS7E | 264 | 8,83747 |
| 6TrsA | 291 | 7,60235 |
| 6U0gd | 188 | 6,60449 |
| 6zUNv | 147 | 7,84472 |
| 6zns6 | 249 | 8,71169 |
| 7EVQe | 189 | 9,44721 |
| 81wbI | 190 | 5,01339 |
| 81xMh | 189 | 5,58440 |
| 88eCf | 187 | 6,73749 |
| 8DJen | 188 | 5,80874 |
| 8F1ht | 187 | 5,52864 |
| 8a9gX | 187 | 6,60102 |
| 8rbru | 187 | 7,72467 |
| AezR | 181 | 8,71659 |
| AgFk | 187 | 7,69642 |
| BsH | 188 | 8,39599 |
| Dnm1 | 191 | 6,31722 |
| PFXd | 190 | 8,90903 |
| dRyp | 198 | 5,51670 |
| jWzn | 189 | 5,95828 |
| s835 | 184 | 6,59579 |
| tdcM | 189 | 8,37246 |
| yMYb | 182 | 5,38546 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_22042
5ukhE
|
104 | 55,5% | 126 | 8.429E-74 |
| 2 |
phalp2_40632
7SWvA
|
1 | 41,2% | 126 | 3.121E-30 |
| 3 |
phalp2_37
7CjdH
|
2 | 25,8% | 143 | 1.182E-17 |
| 4 |
phalp2_1473
1PLYJ
|
2 | 38,2% | 141 | 7.547E-17 |
| 5 |
phalp2_14516
4U1py
|
1 | 29,4% | 129 | 1.630E-11 |
| 6 |
phalp2_23271
4Y2T6
|
95 | 30,2% | 142 | 1.743E-08 |
| 7 |
phalp2_37455
2SP4P
|
199 | 25,4% | 153 | 4.301E-08 |
| 8 |
phalp2_34390
4fPRh
|
1 | 25,7% | 175 | 1.568E-06 |
| 9 |
phalp2_22607
1LayP
|
7 | 24,8% | 161 | 3.066E-05 |
| 10 |
phalp2_39408
4T0un
|
2 | 25,1% | 139 | 1.344E-04 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1Qasw)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50