Protein

Protein accession
53tI1 [EnVhog]
Representative
7vNZv
Source
EnVhog (cluster: phalp2_23565)
Protein name
53tI1
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MIEPPMILQGAARYPVREIILHCSATRPDWLGASSLTAKRAEIRRWHMQDRGWRNIGYHWLIDFDGQRAPGRLETDIGAHVVDHNRGTIGICLIGGHGADADDKFAEHFNSAQARTLRALIADIRNRTQIARVTGHNDYAAKACPGFRVSGWI
Physico‐chemical
properties
protein length:153 AA
molecular weight:17133,3 Da
isoelectric point:9,29
hydropathy:-0,37
Representative Protein Details
Accession
7vNZv
Protein name
7vNZv
Sequence length
208 AA
Molecular weight
22151,89480 Da
Isoelectric point
8,84456
Sequence
MTKEAFRSIQTGLHALGYRPGPIDGIDGPETRSAALAFGQGAPGKPAAGVIKPSTKAMIYQGAARHPVREIIVHCSATRPEWMAGRPIADKVAEIRRWHLANGWSDIGYHWIIDRDGKVLAGRPETVIGAHTVGKNAGSIGICLIGGHGSAETDSFSDHFTRAQDITLGQMIDAISARTQIERVSGHNEYAAKACPGFNVPAWMAGHA
Other Proteins in cluster: phalp2_23565
Total (incl. this protein): 154 Avg length: 198,3 Avg pI: 8,78

Protein ID Length (AA) pI
7vNZv 208 8,84456
11CcZ 158 9,61257
13gwK 208 9,46597
13jh4 256 6,79728
14yDV 208 9,80546
1Ju4E 148 9,21790
1Maba 149 8,58727
1Nuva 210 9,32917
1buO8 242 9,33665
1gn3y 132 9,03178
1oCo6 241 9,67788
1qpUL 205 7,74917
1rrHQ 240 9,96296
2AVw6 274 6,41260
2U58s 151 9,54772
2UcNR 208 8,52635
2UdZC 212 9,09502
2UeOM 154 9,17741
2Uehl 208 7,79160
2Ufrx 208 9,40189
2t6iB 208 7,12661
2tACJ 258 7,89224
2tzLq 212 8,56090
35ett 209 9,71166
37TbQ 207 6,54543
3H6ug 152 9,14279
3Nfi1 275 7,25967
3NqW6 156 8,28562
3Ugoe 153 9,89952
3XgKj 257 8,58069
3Zpwc 165 9,81030
43RJz 153 9,01708
44DL3 215 6,70447
4HJ8T 214 6,37508
4KTYP 150 8,41714
4KlTe 276 5,92765
4KlpS 275 6,69918
4KrH6 211 8,86248
4KuEd 212 9,55681
4PwLo 161 8,92811
4PxfV 282 7,18584
4Pycc 150 7,75167
4RBk8 203 8,82451
4RoZg 210 9,49369
4Rqw0 150 7,00645
4SKaW 257 9,21074
4XDrP 151 9,43413
4YJl7 151 9,24227
4fclH 224 9,27199
4hc6x 231 9,41949
4lc0o 212 8,51075
4mwuN 148 9,29507
4tNXU 253 9,89617
4tO9d 262 9,29778
4uFH9 253 9,66499
593K9 148 9,56010
5C4KJ 148 9,29455
5b61h 148 9,29507
5b9FT 148 8,59604
5c04p 148 9,56010
5daQp 153 10,32315
5fVMe 148 8,83747
5fzaM 148 9,34445
5jizs 212 7,13013
5l8Qv 149 9,00206
5la2T 157 7,05897
5la3F 157 9,38423
5mA8a 153 9,62063
5vdOu 138 9,79876
62Q1 207 8,46143
63IZ 207 6,53855
6PGXE 207 9,33175
6QXLA 211 9,29545
6QXwp 207 9,29487
6Qhll 213 9,55423
6R0vr 226 9,73900
6R2rv 151 7,82532
6R3vk 213 9,29906
6RkXR 158 9,44057
6Rm30 211 8,86268
6RmEt 157 6,69963
6RplY 215 9,54327
6Rvme 219 9,58382
6SU4K 218 9,39370
71TUJ 201 9,53934
7Fpho 207 9,35232
7HH5F 207 6,34723
7HH66 245 9,16445
7HMGs 206 9,29236
7KZRq 205 8,92876
7Kmf2 257 9,39886
7RdKY 212 9,12023
7RdP6 211 8,84340
7aLZ0 206 9,55520
7b58H 213 9,75563
7b59L 214 10,07533
7b59O 212 9,66080
7b5U5 205 8,95455
7cbRe 267 9,09206
7cdS7 267 5,91111
7cnTS 212 9,12036
7d8VK 161 8,88608
7deUl 253 9,80824
7dh9o 202 8,46665
7ffaQ 161 8,55213
7h69d 211 7,94781
7jTU9 223 9,50395
7maDn 253 9,81874
7pgeD 203 7,05289
7poy6 161 8,88608
7rVQa 267 5,78510
7rVrP 154 9,67956
7s6DN 205 8,92876
7s6Os 277 7,77987
7sIhW 207 7,05670
7tGv2 212 7,78786
7vDgP 165 9,25735
7vIGD 154 9,68278
7vJYA 274 6,12300
7vVcH 170 11,16091
7vYcd 207 8,82748
7w75X 267 6,06048
7w77v 267 6,36087
7w7ht 154 9,29977
7w8gQ 257 9,49073
7wF00 219 9,59762
7wbff 211 9,32711
7ypxu 233 9,05789
82QWZ 146 9,38958
82T2i 167 9,47822
82nGa 147 9,55017
82oF9 151 9,15208
83Gim 147 9,55010
83R1t 266 7,14014
8B2iA 208 8,48341
8bjMT 159 9,22667
8e6DL 151 8,49540
8kHC7 146 9,51329
8kHK5 159 9,36663
8mavR 146 9,17032
8rCRY 148 8,56915
8rCdI 167 9,13325
8rCeq 146 8,34390
8sXFP 150 9,32737
CQwA 184 9,71991
OVvV 208 9,29681
cL4i 252 9,64868
e8cn 216 9,66318
iJ2v 222 9,04403
lBx8 213 8,80782
lzT0 206 9,09541
xob8 148 8,84256
F8TVB6 208 8,90503
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_28171
8yYQh
287 62,8% 140 6.264E-66
2 phalp2_20792
5IV86
3 46,6% 135 2.370E-50
3 phalp2_3887
6RreM
7260 44,6% 139 1.030E-48
4 phalp2_23766
13ajC
287 35,8% 201 9.316E-45
5 phalp2_28564
7Z48s
97 42,9% 135 2.390E-44
6 phalp2_36193
72BPm
409 41,2% 143 4.031E-43
7 phalp2_25860
5sv59
16 40,8% 164 1.034E-42
8 phalp2_24237
2YSsA
71 39,3% 150 1.741E-41
9 phalp2_5171
285Oe
13 41,7% 134 2.932E-40
10 phalp2_5712
4IjX3
263 51,4% 138 1.924E-39

Domains

Domains
Unannotated
Ami2
Representative sequence (used for alignment): 7vNZv (208 AA)
Member sequence: 53tI1 (153 AA)
1 208 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01510

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (7vNZv) rather than this protein.
PDB ID
7vNZv
Method AlphaFoldv2
Resolution 91.60
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50