Protein

Protein accession
51J6L [EnVhog]
Representative
2iIxu
Source
EnVhog (cluster: phalp2_14148)
Protein name
51J6L
Lysin probability
95%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
MRFYENIFKPIPSIIFVLGIIIINPFHIPPDPVAQASEIPVMKPILVERTPEASKEFAQKRLDAYGWDTPTQWECLLSLWTKESNWRPNAYNKTPVYQNGEKLHAGGIPQILGLNPDLTVEVQVERGLIYIESRYSNPCSAWRFWERNFWY
Physico‐chemical
properties
protein length:151 AA
molecular weight:17652,1 Da
isoelectric point:6,12
hydropathy:-0,30
Representative Protein Details
Accession
2iIxu
Protein name
2iIxu
Sequence length
159 AA
Molecular weight
18853,91850 Da
Isoelectric point
5,64493
Sequence
MKFYENRILRNIPVAVFTLLLLAANPLHIPPDQPAEALSVINNKKDEVREEIIDWNPQTLRKYAKGLLDEYGWDTPEQWTCLNRLWGKESAWNHESVYDPTDDYGVPQRHMSRNSPEEIKDFMADPQGQIRWGLSYIAHRYDTPCGAWNFWHHQGNRWY
Other Proteins in cluster: phalp2_14148
Total (incl. this protein): 157 Avg length: 151,9 Avg pI: 7,22

Protein ID Length (AA) pI
2iIxu 159 5,64493
156ko 152 6,73590
15ZAw 154 6,60818
15mv5 152 6,30836
15shN 157 5,53421
17IYj 153 7,75695
17WDO 154 5,90684
17XYd 150 7,75695
18KoB 147 9,54366
19PDn 151 6,72373
19Rp9 151 6,30216
1JAjL 151 7,71916
1JDdp 151 7,75604
1Kg9v 152 6,82985
1O74m 152 8,90536
1OBS5 149 9,43980
1argF 130 8,53247
1cL0z 126 9,56957
1eAAZ 151 7,74337
1h2ea 149 9,64520
1mODY 152 7,75064
1pGUn 193 9,45966
1rKBv 151 6,82764
1sRbS 151 8,56284
1tL3I 151 6,96144
1xPN7 153 7,75047
1y8WS 151 8,47445
21ekT 151 6,57379
27eLN 151 7,74337
2C2X1 154 9,62469
2cVZq 151 5,42070
2d1Tk 151 6,73641
2d6Jt 153 5,90207
2d73L 152 6,14506
2hHeM 147 9,61161
2hOpT 152 6,73249
2hVlr 153 6,29028
2hXim 153 7,76906
2jh6b 152 6,28619
2jniz 150 6,72697
31MdF 153 7,76724
31PSv 154 6,29028
31SgQ 151 6,30114
31Tfh 152 5,91372
32O3I 151 6,73760
32ftv 151 5,60162
32xc1 154 6,41044
370fa 130 8,91135
38bhi 154 6,82479
38ccv 151 6,13744
38jya 154 5,62680
38mXE 151 5,72451
3RTX 157 7,73359
3XryV 151 6,73601
3zBKP 151 6,59880
44jrT 156 6,82627
45U0U 156 8,54794
46EMw 154 6,29267
48Z8n 178 6,18450
48ems 159 5,25916
497yS 161 5,57036
49DXs 156 8,54781
49ktN 152 6,58584
49stX 156 6,07634
4AbuA 153 5,28531
4CS0E 157 6,73902
4CS8k 153 6,73829
4CkAl 154 6,82883
4YfTP 151 6,73175
4aDTU 147 9,72623
4aE4s 155 7,74348
4aYSO 154 6,29034
4arI8 150 8,53112
4b4DC 154 6,29267
4bCqN 147 9,61161
4bEKg 153 5,91372
4biGt 151 6,13738
4eaxh 151 6,28624
4lmfT 151 8,46136
4ndKl 154 6,29881
4oPk3 152 7,76304
4oS6N 156 6,82735
4rrW1 152 6,28016
50fTV 149 9,58646
54ZbU 152 6,83656
55xZx 149 9,49544
56F5a 154 5,58229
56HIb 156 5,90213
56NzE 150 6,73215
58qHJ 151 5,93322
59YCD 151 8,53112
5CbdV 151 6,13738
5Cpg4 149 9,47339
5aS1M 151 6,73760
5acDZ 153 6,13340
5ctRu 152 5,45310
5ddmz 156 6,28659
5eOAD 156 6,29631
5gHW5 151 7,75599
5hDg7 149 9,59923
5hjQT 152 6,83656
5kvPp 151 6,74101
5lTAy 152 8,88531
5m8YB 154 7,77581
5m96U 129 8,84850
5nm4W 152 6,12749
5nvO0 151 6,73016
5uAEv 151 6,12340
5vSkT 151 8,86577
5w8Sx 154 6,28897
5xS0O 151 6,73681
6A2VQ 156 7,76940
6BVNo 154 6,29380
6IHPB 151 5,44543
6zD07 170 8,81446
6zENY 151 6,13153
6zidS 151 6,13153
6zw3M 170 8,81446
6zxv8 153 7,77581
7XEWG 150 9,49531
7XbLm 147 9,49524
7Xg9I 152 6,74027
83nKx 129 9,41988
86S8t 151 9,09670
87pfL 147 9,49524
88xoE 158 5,63373
891i2 151 7,72950
8JyRt 150 6,73215
8jqtq 129 9,44863
8mAos 152 5,69148
8mW4q 152 6,73942
8rcGR 152 6,29375
8sNUo 158 5,92924
8st1w 151 8,51461
C2kL 157 6,83565
C8FO 151 5,72769
CdHq 150 7,74280
Ckrx 148 9,58653
DkOx 154 9,07536
FPmI 122 7,91512
FQKV 151 7,75008
FRn2 151 6,82593
FgfE 151 7,72103
FpN5 151 7,77048
HgNw 151 6,74215
LFiF 151 6,12948
LSv1 149 9,39512
Liqd 151 6,12948
Q85i 151 6,28767
SDjY 129 8,59804
TJSR 151 6,27988
TRb3 152 6,28619
Uo14 151 5,91367
UpgZ 191 7,71091
X9fQ 163 5,61964
sRmW 151 6,73408
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_2932
U3n1
1044 39,2% 112 2.536E-33
2 phalp2_6108
5elq8
169 48,0% 100 2.298E-32
3 phalp2_35084
5danD
7 41,4% 111 3.148E-32
4 phalp2_28855
57haC
91 48,5% 105 7.424E-28
5 phalp2_5873
5BDhB
15 33,0% 100 1.911E-21
6 phalp2_28896
5ouYs
43 39,8% 108 4.895E-21
7 phalp2_23661
8MCi0
53 33,3% 117 4.895E-21
8 phalp2_38619
2aAe3
5 35,5% 107 6.698E-21
9 phalp2_5853
5tr9z
1185 38,3% 99 6.007E-20
10 phalp2_30224
4aiz2
5 37,1% 105 2.103E-19

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 2iIxu (159 AA)
Member sequence: 51J6L (151 AA)
1 159 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (2iIxu) rather than this protein.
PDB ID
2iIxu
Method AlphaFoldv2
Resolution 82.12
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50