Protein
- Protein accession
- 5106j [EnVhog]
- Representative
- 5yPNK
- Source
- EnVhog (cluster: phalp2_11142)
- Protein name
- 5106j
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MSIVINGKKIETPGLQTISWLDDPKVPQATDFNPRAMWIRAIVLHTVHGKSGRLLPGLSKPSSRAKSYARYQANTARKVSWDYTVGTDGTIIASNDPVKTYTWHAGDVNPYTVGIEFVQEDNGDLYEGQMDVVVRFLDVLTRELADAGHPIQRQVPMTSNGEPVKGVIARIENNDSAKQVVGIYGHRNQTGQKPVGDPGDAIFHALLRAGYKGFNLDAKDDITFWKDVQARLGLSPADGIPGRATQQALLNAGNPHGLWVERPGDR
- Physico‐chemical
properties -
protein length: 266 AA molecular weight: 29146,5 Da isoelectric point: 7,93 hydropathy: -0,45
Representative Protein Details
- Accession
- 5yPNK
- Protein name
- 5yPNK
- Sequence length
- 263 AA
- Molecular weight
- 28647,00180 Da
- Isoelectric point
- 8,58289
- Sequence
-
MLILNGVAKEVPGIVTSNWRDNNAIRLKMGNDGRSRPKPRIRRIIIHSTGGIPGGRDQRPQVILPGFGPPGNAAEDNVRYWTGNAGQAGAHLLVDRDGSVIQTCDLITEVAYHMPGVSFDSIGIEIVQFSRDASIYQGQLDVTARLVRWLCGQTGVQFQTHWPYRVGRKRLNLDAYQGPVGVFGHYQGDQGRGIGDPGDAMWLALEAVGVEKFDFFSPDADAIWRERQRELGVTADGDPGPATVAALKARGYAHGIRAFGFTA
Other Proteins in cluster: phalp2_11142
| Total (incl. this protein): 138 | Avg length: 263,9 | Avg pI: 7,12 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 5yPNK | 263 | 8,58289 |
| 16OR3 | 283 | 6,11976 |
| 16QXm | 272 | 6,25964 |
| 16Qkz | 283 | 5,81909 |
| 16fLW | 265 | 6,60142 |
| 18peZ | 242 | 9,28927 |
| 19RIF | 270 | 7,62270 |
| 1DWPL | 280 | 8,48663 |
| 1Iw6x | 268 | 5,59537 |
| 1IynQ | 294 | 8,29910 |
| 1Mja2 | 223 | 8,89369 |
| 1PYH3 | 266 | 6,99974 |
| 1QmsC | 271 | 7,60048 |
| 1XDry | 267 | 8,21368 |
| 1XGsq | 266 | 5,88229 |
| 1XqSg | 222 | 6,69969 |
| 1idur | 277 | 6,32495 |
| 1igUO | 260 | 6,59141 |
| 1k0Cm | 273 | 7,66573 |
| 1ky7T | 271 | 8,16732 |
| 1lToh | 304 | 6,23316 |
| 1nsdb | 271 | 8,41043 |
| 1oJRb | 285 | 5,95010 |
| 1onl0 | 271 | 5,75196 |
| 1pmIs | 247 | 9,12506 |
| 1zFdg | 274 | 5,99591 |
| 22eeE | 267 | 5,89184 |
| 2SDy6 | 269 | 6,06378 |
| 2b6eX | 266 | 6,70805 |
| 2cjqr | 273 | 6,66610 |
| 2hMtS | 265 | 7,02731 |
| 2mG4I | 291 | 6,90619 |
| 2oP20 | 272 | 6,37417 |
| 2tEEI | 257 | 8,66914 |
| 31u5T | 271 | 8,49605 |
| 34mEO | 241 | 8,93211 |
| 35M6H | 255 | 6,65973 |
| 36qS3 | 262 | 6,25629 |
| 3NJoo | 258 | 7,01833 |
| 3eJae | 278 | 5,48828 |
| 3iLZh | 276 | 6,12545 |
| 3mZw7 | 265 | 7,92634 |
| 42hgK | 292 | 6,09555 |
| 43P5J | 271 | 6,65524 |
| 44PWO | 271 | 6,35593 |
| 45caH | 265 | 6,15046 |
| 46mFa | 271 | 8,51809 |
| 47uHE | 265 | 6,30745 |
| 485mj | 215 | 7,19385 |
| 496Sm | 271 | 7,62077 |
| 4BO3j | 263 | 6,25800 |
| 4DCXv | 271 | 7,60417 |
| 4DvnM | 267 | 6,21144 |
| 4Fa0n | 265 | 7,87715 |
| 4G5I9 | 209 | 8,57579 |
| 4Gkfr | 277 | 6,96473 |
| 4IAcj | 288 | 6,49757 |
| 4JraE | 296 | 5,83801 |
| 4MXvU | 266 | 6,06804 |
| 4NYaA | 245 | 8,57347 |
| 4W4mr | 286 | 6,09606 |
| 4bMW2 | 265 | 6,52605 |
| 4cbdF | 265 | 6,20963 |
| 4dKhe | 257 | 5,60583 |
| 4dLqG | 262 | 5,97465 |
| 4eBFW | 264 | 6,71402 |
| 4eDT2 | 221 | 5,30572 |
| 4fj2S | 264 | 8,75495 |
| 4fkwe | 268 | 7,92789 |
| 4g1Vt | 264 | 8,85920 |
| 4gQ4C | 227 | 8,44576 |
| 4gTuC | 197 | 6,01933 |
| 4gyGm | 213 | 9,04119 |
| 4hymd | 262 | 6,86930 |
| 4mcxH | 234 | 6,70873 |
| 4o3vU | 211 | 7,24165 |
| 4wbCE | 276 | 6,90943 |
| 561ON | 271 | 8,11762 |
| 5CqSH | 229 | 7,90726 |
| 5InEc | 266 | 6,51764 |
| 5JFWH | 266 | 6,13142 |
| 5JFnZ | 266 | 5,97534 |
| 5aIhm | 234 | 6,64587 |
| 5c1cm | 245 | 9,05518 |
| 5dJSn | 266 | 6,00699 |
| 5hK8U | 271 | 6,66542 |
| 5k15Y | 256 | 6,40578 |
| 5kDG2 | 237 | 8,84875 |
| 5l04E | 273 | 8,24720 |
| 5l0LW | 269 | 5,98579 |
| 5l1TB | 273 | 7,69886 |
| 5l2IN | 265 | 6,90835 |
| 5xNvs | 209 | 8,57579 |
| 6AAFA | 209 | 8,57579 |
| 6GDyb | 277 | 8,66805 |
| 6Gv34 | 274 | 7,71205 |
| 6HUOl | 259 | 5,79226 |
| 6I0Fj | 263 | 5,27940 |
| 6Ie9t | 281 | 5,71916 |
| 6SLh3 | 279 | 6,21730 |
| 6U6cQ | 279 | 5,85978 |
| 6VGb0 | 279 | 6,53821 |
| 6VQ4r | 272 | 7,14889 |
| 6Vezn | 309 | 7,13224 |
| 7YVws | 352 | 8,58959 |
| 80JPT | 271 | 7,62270 |
| 8198Z | 245 | 9,01418 |
| 87n5c | 217 | 7,75576 |
| 89K4d | 275 | 6,13647 |
| 8aQRJ | 229 | 7,84446 |
| 8b9Fe | 280 | 7,64964 |
| 8b9K3 | 267 | 7,76457 |
| 8cafz | 206 | 9,67098 |
| 8d6c1 | 315 | 9,02424 |
| 8iIRh | 221 | 6,19115 |
| 8iOva | 296 | 6,53867 |
| 8io3y | 233 | 7,71899 |
| 8ioge | 267 | 6,96882 |
| 8j7y5 | 209 | 6,13437 |
| 8j8xG | 289 | 7,74797 |
| 8jn9F | 213 | 7,92943 |
| 8sTn0 | 322 | 7,69841 |
| 99AE | 277 | 6,83468 |
| PXJl | 263 | 7,11007 |
| Yo7X | 265 | 7,01134 |
| aRR8 | 266 | 8,66225 |
| fIbF | 286 | 6,49979 |
| fOGj | 287 | 8,63220 |
| fREl | 284 | 5,75747 |
| fX7I | 306 | 6,02518 |
| hO8Z | 245 | 8,98285 |
| hjDP | 260 | 5,68426 |
| iE3i | 292 | 7,09177 |
| iHAi | 275 | 5,93373 |
| iO6F | 264 | 6,76011 |
| k2OS | 279 | 5,85950 |
| kb1y | 281 | 6,25601 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_5603
4ezC3
|
11 | 28,7% | 278 | 2.624E-60 |
| 2 |
phalp2_15513
8a3li
|
1 | 25,8% | 213 | 5.973E-26 |
| 3 |
phalp2_22012
59QfH
|
56 | 21,7% | 239 | 2.933E-18 |
| 4 |
phalp2_9065
5sRvP
|
49 | 20,9% | 243 | 9.837E-18 |
| 5 |
phalp2_30132
3gxUn
|
18 | 19,1% | 235 | 6.023E-17 |
| 6 |
phalp2_3964
7rht2
|
43 | 24,0% | 233 | 1.590E-12 |
| 7 |
phalp2_22201
6VaYI
|
26 | 24,0% | 258 | 9.418E-12 |
| 8 |
phalp2_570
PDRe
|
48 | 22,7% | 242 | 1.702E-11 |
| 9 |
phalp2_10807
3Y3O1
|
11 | 21,6% | 162 | 1.888E-09 |
| 10 |
phalp2_31828
4uKKn
|
909 | 17,5% | 222 | 1.460E-08 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(5yPNK)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50