Protein
- Protein accession
- 4ydYq [EnVhog]
- Representative
- 5ZpHn
- Source
- EnVhog (cluster: phalp2_17560)
- Protein name
- 4ydYq
- Lysin probability
- 89%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MLRYIIPYIISVALCIAPSADLAVDRIPCADEVDETALSEVRAIAQTVWGEGRGLNEYEQSLIVWCILNRVDDERFPDDIMSVITAPSQFMGYSKHNPVDPDIYDLCIQVCTDWVMGVERPLPQQYVFFAGDGKHNYYRDSSGNMFSLTN
- Physico‐chemical
properties -
protein length: 150 AA molecular weight: 16976,1 Da isoelectric point: 4,29 hydropathy: -0,04
Representative Protein Details
- Accession
- 5ZpHn
- Protein name
- 5ZpHn
- Sequence length
- 175 AA
- Molecular weight
- 19280,92010 Da
- Isoelectric point
- 4,10772
- Sequence
-
MNKYTIIIAQVCAVLLALIMLILLAIDGGVIEADADGVPPEVDTNGLCVVEIAEPAEPEYEMYFTEADVIALAQMLYGEARGCTVDNQAKCVWCVLNRVDDARFPDTIIGVVSAPGQFYGYSPDFPVLDRLYAVALDVLTRWSMEKQGADVARELEKNAVFFTGDGIQNWFRSVY
Other Proteins in cluster: phalp2_17560
| Total (incl. this protein): 163 | Avg length: 187,5 | Avg pI: 4,56 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 5ZpHn | 175 | 4,10772 |
| 135Tu | 236 | 4,54197 |
| 13Cew | 144 | 4,59995 |
| 13DLo | 203 | 4,61927 |
| 13FrF | 213 | 4,42806 |
| 13rsa | 202 | 4,41204 |
| 13zzF | 227 | 5,41291 |
| 19joI | 171 | 4,58812 |
| 1FY87 | 202 | 4,79428 |
| 1cu0Q | 179 | 4,92927 |
| 1jCrS | 147 | 8,18789 |
| 1jDas | 180 | 4,50696 |
| 1o5Ns | 157 | 4,43170 |
| 1oaWb | 181 | 4,48581 |
| 23tRk | 192 | 5,81459 |
| 2c08i | 217 | 4,41596 |
| 3KcQ7 | 168 | 4,71516 |
| 3PInM | 209 | 4,34599 |
| 3ZJpp | 231 | 4,64564 |
| 3aqqu | 151 | 5,72360 |
| 3iZ3O | 209 | 4,34599 |
| 3m6Nd | 179 | 5,13958 |
| 3oojv | 170 | 4,22731 |
| 3pBpO | 204 | 4,47700 |
| 3pIfm | 204 | 4,41425 |
| 3qEEf | 226 | 4,71851 |
| 3sjBH | 207 | 8,46568 |
| 3tR8k | 179 | 5,00703 |
| 3tRYn | 174 | 4,57045 |
| 3tlTk | 172 | 4,33542 |
| 3uR8d | 200 | 4,18633 |
| 3uV9F | 179 | 5,13958 |
| 3v7kS | 233 | 7,56927 |
| 3vX67 | 204 | 4,47700 |
| 3vYri | 226 | 4,71527 |
| 3vsAp | 132 | 4,41164 |
| 40k98 | 153 | 4,46416 |
| 4L8S4 | 196 | 4,35707 |
| 4OevR | 155 | 4,63820 |
| 4xsUN | 203 | 4,29245 |
| 5Ari | 162 | 4,43290 |
| 5KQVs | 196 | 4,20406 |
| 5Ko0v | 170 | 4,09516 |
| 5LKY2 | 204 | 4,47700 |
| 5LZhJ | 172 | 4,24408 |
| 5MMNu | 172 | 4,42346 |
| 5Ndmk | 172 | 4,47717 |
| 5NhnB | 182 | 5,47242 |
| 5NlXr | 205 | 4,33735 |
| 5OkgK | 204 | 4,53890 |
| 5P919 | 204 | 4,42778 |
| 5PayO | 172 | 4,18542 |
| 5Q8yT | 198 | 4,09601 |
| 5QZDG | 204 | 4,11153 |
| 5Qc8T | 172 | 4,32592 |
| 5SSVq | 198 | 4,05003 |
| 5SqT1 | 198 | 4,06981 |
| 5SwbT | 204 | 4,44563 |
| 5TAme | 207 | 4,65440 |
| 5TsOt | 204 | 4,41425 |
| 5VM0M | 226 | 4,56039 |
| 5Vsba | 172 | 4,23959 |
| 5WD1B | 201 | 4,67963 |
| 5WIHV | 172 | 4,36031 |
| 5WnL3 | 204 | 4,41425 |
| 5XRbM | 172 | 4,25948 |
| 5YJJN | 172 | 4,24271 |
| 5ZcyK | 166 | 5,03636 |
| 5Zlu0 | 190 | 4,12125 |
| 5ZsQJ | 204 | 4,41425 |
| 5Zwez | 172 | 4,19770 |
| 6051K | 172 | 4,38515 |
| 60AUp | 172 | 4,46905 |
| 60eAj | 172 | 4,19645 |
| 617ny | 204 | 4,41511 |
| 62OED | 185 | 4,67236 |
| 62PJ6 | 204 | 4,47700 |
| 62rnj | 204 | 4,46348 |
| 62wcQ | 175 | 4,09243 |
| 62zfx | 172 | 4,32592 |
| 634EO | 204 | 4,37731 |
| 636Lu | 204 | 4,41425 |
| 63Jct | 185 | 4,15916 |
| 63PG7 | 172 | 4,27193 |
| 64W4p | 172 | 4,25948 |
| 64Zo0 | 206 | 4,33269 |
| 64kr0 | 206 | 4,41442 |
| 65YDm | 215 | 4,24771 |
| 65z2J | 204 | 4,38555 |
| 66dxR | 198 | 4,19502 |
| 67vg4 | 172 | 4,42573 |
| 68uqJ | 204 | 4,43250 |
| 69JQT | 198 | 4,22430 |
| 69RwF | 180 | 4,49485 |
| 69j4P | 206 | 4,44165 |
| 69zL5 | 172 | 4,37276 |
| 6aF3x | 204 | 4,59256 |
| 6aTPr | 206 | 4,41442 |
| 6aYXR | 168 | 4,57681 |
| 6aqH0 | 191 | 4,17604 |
| 6ar6L | 172 | 4,27375 |
| 6bpyl | 172 | 4,44978 |
| 6c0yF | 215 | 4,51935 |
| 6dM5h | 172 | 4,24271 |
| 6dT1L | 183 | 4,73102 |
| 6entx | 187 | 4,42585 |
| 6fHmc | 223 | 4,22646 |
| 6hUqY | 204 | 4,44563 |
| 6iotS | 206 | 4,54527 |
| 6k2Mn | 172 | 4,21668 |
| 6k5t6 | 172 | 4,28273 |
| 6k7mQ | 172 | 4,44745 |
| 6kGOK | 221 | 4,62672 |
| 6kdLk | 172 | 4,48530 |
| 6lKM5 | 172 | 4,33604 |
| 6lNSY | 167 | 4,69760 |
| 6lTKT | 223 | 4,20906 |
| 6m48d | 204 | 4,46348 |
| 6m95h | 168 | 4,49423 |
| 6mLEp | 230 | 4,78439 |
| 6nGRu | 183 | 4,54606 |
| 6ocmL | 202 | 7,75133 |
| 6pcDP | 166 | 5,01345 |
| 6pdoz | 172 | 4,63462 |
| 6psn9 | 204 | 4,40391 |
| 6qRFT | 167 | 5,66869 |
| 6qcOF | 173 | 4,05003 |
| 6r548 | 133 | 4,37481 |
| 6rY5A | 172 | 4,24408 |
| 6sEVs | 207 | 4,21412 |
| 6sR4V | 206 | 4,33854 |
| 6sbVC | 164 | 4,58738 |
| 6tDts | 179 | 4,92069 |
| 6tLfU | 167 | 4,71618 |
| 6trVk | 172 | 4,42960 |
| 6vKM4 | 172 | 4,41653 |
| 6vegD | 206 | 4,38936 |
| 6vm00 | 172 | 4,18457 |
| 6vpbL | 172 | 4,16047 |
| 6wKys | 172 | 4,27193 |
| 7QIla | 202 | 4,79428 |
| 7UZmq | 181 | 4,29728 |
| 7YBSQ | 162 | 4,25380 |
| 7vEUz | 225 | 4,65599 |
| 80RRI | 198 | 4,19502 |
| 84MWl | 173 | 4,11278 |
| 84RYK | 197 | 4,37361 |
| 84TH1 | 162 | 4,22600 |
| 84h20 | 162 | 4,20014 |
| 87FrJ | 187 | 4,37276 |
| 89VfC | 183 | 4,97787 |
| 8bFyS | 173 | 4,40522 |
| 8fAJs | 172 | 4,88630 |
| 8mOgO | 172 | 4,35378 |
| 8nXR2 | 180 | 4,61245 |
| 8pWj4 | 183 | 4,68850 |
| 8pury | 177 | 4,16990 |
| 8rEjz | 197 | 4,30131 |
| 8skh9 | 183 | 4,76682 |
| BQRa | 204 | 4,47700 |
| oKQL | 204 | 4,44563 |
| ok46 | 207 | 4,23106 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_32116
6u4lU
|
174 | 48,9% | 147 | 4.660E-55 |
| 2 |
phalp2_8950
3phdJ
|
693 | 42,4% | 186 | 2.253E-54 |
| 3 |
phalp2_37880
4UfBM
|
229 | 50,3% | 131 | 2.369E-48 |
| 4 |
phalp2_16676
ovpD
|
20 | 46,8% | 128 | 1.060E-43 |
| 5 |
phalp2_27309
4kokU
|
6 | 33,7% | 175 | 5.282E-37 |
| 6 |
phalp2_38070
6vh4e
|
7 | 43,3% | 113 | 1.230E-26 |
| 7 |
phalp2_10953
4JVN9
|
1 | 34,6% | 127 | 1.352E-24 |
| 8 |
phalp2_19319
8tomk
|
3 | 29,4% | 139 | 3.460E-24 |
| 9 |
phalp2_1335
14NLd
|
89 | 25,7% | 136 | 5.833E-13 |
| 10 |
phalp2_10810
45p5h
|
5 | 33,0% | 121 | 1.082E-12 |
Domains
Domains
1
175 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(5ZpHn)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50