Protein
- Protein accession
- 4nQHo [EnVhog]
- Representative
- 8jGq0
- Source
- EnVhog (cluster: phalp2_26568)
- Protein name
- 4nQHo
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 69% (predicted by ML model) - Protein sequence
-
MAETIPTPALGLLAFIASYEAPKGYDTVYANRMAQMPKPLTSMSLNEVIADGPRRTKLFGSSACGRYQFMTATLKDLQKTLVLMGNDLFTPELQDRLGYELLKRRGYIKFALGAMSVQAFGLGLAQEWASFPVLAAVKGGSRNVVRGQSYYAGDGLNKALVKPDAVEAALARVLAASRAEPSPPALPAPSPVPAVPAAVVVPVPTVPGAVVAIPTPEARNLWQRVADRLRAAFPPNKG
- Physico‐chemical
properties -
protein length: 238 AA molecular weight: 25288,2 Da isoelectric point: 9,77 hydropathy: 0,07
Representative Protein Details
- Accession
- 8jGq0
- Protein name
- 8jGq0
- Sequence length
- 212 AA
- Molecular weight
- 23722,73320 Da
- Isoelectric point
- 9,21874
- Sequence
-
MNEFTTNLLDIIRQKESQGNYNIFAGDKPTADRKLTNRTLNDVIRIQGNKAAGAYQFKPQTLKTLMKDMGLKGNERFTPELQDQLAMRLLERRGLNDYLSGNVDTPTFGLNLAKEWASLPVLSPTKGYRGRAVEPGMSFYEGYGSNRALLKGEDFDRYQTLLSMGAPKPEVVPARGILSQAAEMVTAPITAATDYLSDVFWNPRKMFGRTTD
Other Proteins in cluster: phalp2_26568
| Total (incl. this protein): 165 | Avg length: 241,3 | Avg pI: 9,23 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8jGq0 | 212 | 9,21874 |
| 16ADB | 202 | 7,91519 |
| 1GCq2 | 226 | 9,40376 |
| 1GWMo | 235 | 9,25213 |
| 1GWfs | 226 | 9,46655 |
| 1H26J | 222 | 7,78922 |
| 1KAcH | 191 | 9,19720 |
| 1MBXe | 223 | 9,98759 |
| 1Y4Fu | 236 | 8,97988 |
| 1Y5Z8 | 223 | 9,56416 |
| 1a3Ge | 272 | 9,78780 |
| 1bDpH | 275 | 9,68110 |
| 1bWtI | 295 | 9,85614 |
| 1c1Hb | 272 | 9,47668 |
| 1cnDq | 286 | 9,89359 |
| 1cnzv | 286 | 9,84079 |
| 1cpnd | 233 | 9,70702 |
| 1eVB2 | 271 | 9,41433 |
| 1fPEJ | 222 | 9,54533 |
| 1ftMm | 279 | 9,91777 |
| 1iNkb | 232 | 8,34912 |
| 1iglN | 306 | 9,89308 |
| 1kkK1 | 268 | 9,55307 |
| 1lp0y | 223 | 9,74905 |
| 1oOZX | 194 | 8,76888 |
| 1qOpX | 239 | 9,84595 |
| 1roGj | 239 | 9,58034 |
| 1rpwG | 236 | 9,17464 |
| 1rtHq | 224 | 9,72088 |
| 2B9DQ | 224 | 9,69290 |
| 2Fnpb | 215 | 9,09438 |
| 2HKlL | 176 | 6,49842 |
| 2QyoL | 236 | 7,90423 |
| 2WBX2 | 233 | 9,63546 |
| 2Y2VP | 212 | 8,92180 |
| 2cFfE | 202 | 7,95709 |
| 2cSyq | 239 | 9,70863 |
| 2kWPA | 236 | 5,46037 |
| 2l2zF | 232 | 5,40712 |
| 2rBX2 | 235 | 8,99871 |
| 2rxHt | 234 | 6,78467 |
| 3Lnkj | 295 | 9,94356 |
| 3MLIP | 218 | 9,56957 |
| 3YQvK | 234 | 10,52442 |
| 3bJsk | 216 | 9,09586 |
| 3bZxP | 229 | 9,79128 |
| 3dMDX | 239 | 9,00051 |
| 3hPu7 | 202 | 9,63669 |
| 4CbKu | 231 | 9,98939 |
| 4CvAW | 279 | 9,74216 |
| 4E2TC | 178 | 9,65970 |
| 4E33K | 178 | 9,76053 |
| 4E4hH | 178 | 9,72681 |
| 4LlT2 | 270 | 9,75144 |
| 4LyM1 | 209 | 9,67337 |
| 4MMgW | 256 | 9,82577 |
| 4MPwm | 218 | 9,54965 |
| 4QuLm | 234 | 10,26016 |
| 4TZ7l | 271 | 9,00960 |
| 4eGvi | 230 | 9,68310 |
| 4f7i8 | 236 | 9,69322 |
| 4fvBh | 220 | 9,74654 |
| 4gGGW | 239 | 9,57306 |
| 4gHU0 | 200 | 9,69625 |
| 4kQsp | 185 | 9,54952 |
| 4lmrQ | 211 | 9,32092 |
| 54ixC | 212 | 8,94023 |
| 5E7fl | 212 | 8,97917 |
| 5IV1W | 220 | 10,40908 |
| 5J4p1 | 250 | 5,31134 |
| 5hV3i | 234 | 8,96015 |
| 6DSKX | 262 | 9,59278 |
| 6EK82 | 262 | 9,61309 |
| 6EZeU | 262 | 9,68343 |
| 6PLJb | 147 | 7,92299 |
| 6Q9Uz | 264 | 9,76375 |
| 6QsiR | 210 | 9,24001 |
| 6QykT | 241 | 5,49175 |
| 6RuHV | 272 | 9,66937 |
| 6RuuI | 226 | 9,19359 |
| 6Rvjr | 202 | 9,18244 |
| 6Ryas | 236 | 8,94372 |
| 6Rzns | 232 | 9,07510 |
| 6T9AW | 243 | 10,17448 |
| 6T9MM | 280 | 9,53334 |
| 6TgOl | 222 | 9,07594 |
| 6X5KC | 295 | 9,66628 |
| 6x2Z5 | 216 | 9,32002 |
| 6x4Md | 263 | 8,68075 |
| 74ZIm | 200 | 9,24826 |
| 752Ip | 228 | 9,68233 |
| 75twB | 218 | 9,81094 |
| 78NhF | 295 | 10,31683 |
| 78Wny | 225 | 9,56461 |
| 79GZU | 259 | 9,73545 |
| 7BTWw | 271 | 9,69303 |
| 7BeuZ | 271 | 9,72527 |
| 7BiBr | 250 | 7,79850 |
| 7BkHl | 200 | 9,29842 |
| 7BwTV | 252 | 9,32827 |
| 7BwYe | 230 | 9,70973 |
| 7HIDU | 302 | 9,31460 |
| 7RcRs | 238 | 9,72475 |
| 7RcxF | 288 | 9,75492 |
| 7TNet | 239 | 6,61688 |
| 7YVPM | 220 | 9,72436 |
| 7cMM1 | 272 | 9,62753 |
| 7cZTC | 225 | 9,65306 |
| 7ctjt | 298 | 9,33375 |
| 7ddPi | 231 | 9,74480 |
| 7dpRc | 224 | 9,87509 |
| 7dxUQ | 248 | 8,44815 |
| 7eqYq | 298 | 9,60709 |
| 7hEbP | 242 | 9,73829 |
| 7hzVx | 219 | 9,85188 |
| 7on3c | 228 | 8,50946 |
| 7otzz | 297 | 9,34774 |
| 7pk6W | 281 | 9,55616 |
| 7pker | 272 | 9,77942 |
| 7pkpX | 272 | 9,82887 |
| 7pqXn | 236 | 9,42916 |
| 7qZHR | 242 | 9,75969 |
| 7qrnx | 272 | 9,59717 |
| 7rJIP | 272 | 9,61883 |
| 7rJJN | 221 | 9,32027 |
| 7rKd3 | 209 | 7,77423 |
| 7rMcB | 232 | 9,95226 |
| 7rNoa | 297 | 7,07665 |
| 7rhU0 | 272 | 9,71560 |
| 7rhXU | 272 | 9,73822 |
| 7sDZi | 271 | 9,76137 |
| 7sOch | 299 | 9,41285 |
| 7tG7m | 275 | 9,53818 |
| 7tGiu | 275 | 9,37024 |
| 7tJDf | 225 | 9,80031 |
| 7tLzb | 263 | 9,83377 |
| 7w3aA | 249 | 9,88257 |
| 7w4eJ | 238 | 9,48718 |
| 7wDXb | 286 | 9,71669 |
| 7wJ1A | 231 | 9,82854 |
| 7wTOv | 227 | 9,95219 |
| 7wgdd | 226 | 9,40370 |
| 7woV5 | 303 | 9,87361 |
| 7y0gz | 272 | 9,48009 |
| 7y0mM | 273 | 9,57886 |
| 7y2Kv | 271 | 9,80282 |
| 7yh6o | 273 | 9,81604 |
| 7yj7B | 234 | 9,37430 |
| 83bQL | 212 | 9,02204 |
| 8dKsJ | 216 | 8,99097 |
| 8eiFF | 256 | 9,26812 |
| 8lilK | 248 | 4,73062 |
| 8oKvn | 247 | 8,57908 |
| 8wbJV | 239 | 6,61688 |
| OW1W | 218 | 9,58717 |
| OWgR | 235 | 9,91977 |
| aJiA | 220 | 9,83377 |
| brM6 | 177 | 9,61464 |
| dhwi | 250 | 9,48628 |
| fqBh | 236 | 9,36824 |
| fuOv | 273 | 9,40911 |
| gliw | 201 | 4,67247 |
| lKkA | 244 | 9,71959 |
| vgRn | 247 | 9,26535 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_30712
7fryy
|
92 | 38,9% | 195 | 5.107E-75 |
| 2 |
phalp2_35822
4E3bu
|
2 | 37,2% | 185 | 3.031E-57 |
| 3 |
phalp2_1193
8DjT6
|
74 | 37,4% | 171 | 3.752E-56 |
| 4 |
phalp2_38432
1a5N2
|
26 | 43,1% | 169 | 3.827E-44 |
| 5 |
phalp2_32734
7nLzS
|
2 | 31,4% | 140 | 7.711E-36 |
| 6 |
phalp2_28146
9QdO
|
38 | 34,4% | 180 | 1.289E-34 |
| 7 |
phalp2_39615
6FEeA
|
19 | 33,7% | 163 | 6.430E-29 |
| 8 |
phalp2_27456
7HO5J
|
1 | 31,5% | 152 | 9.995E-25 |
| 9 |
phalp2_34739
3dqoF
|
1 | 29,6% | 152 | 6.445E-24 |
| 10 |
phalp2_17594
6xG4e
|
8 | 32,9% | 158 | 2.332E-21 |
Domains
Domains
1
212 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8jGq0)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50