Protein
- Protein accession
- 4gGoh [EnVhog]
- Representative
- 7EhAU
- Source
- EnVhog (cluster: phalp2_11040)
- Protein name
- 4gGoh
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 89% (predicted by ML model) - Protein sequence
-
MANLELNKRLVKDVQKSLGFVSNDIDGIVGPKTRSAIASYQTRNNLVVTGIINQELIESLGCIDTDKSNSVYTINGIKFENHFLDKDEYIDTEINKNDYLFLHHTAGWNNPFKTIDDWNKDDRGKIGTEFVIGGQNIKTGDNSYDGRIVKAFPDGCNAYHLGSTGSQYMNIHSVGIEVCNFGFIKDGKTYVGTPALEEQIITLNQAFRGYTQWHKYSYKQLENLRYLILYIANRDNINVHEGVYQWIKKGVDNAFAFHKEAYDGKIKGLLFHCNVNKEKFDMFPQQELIDMILTL
- Physico‐chemical
properties -
protein length: 295 AA molecular weight: 33673,6 Da isoelectric point: 5,99 hydropathy: -0,43
Representative Protein Details
- Accession
- 7EhAU
- Protein name
- 7EhAU
- Sequence length
- 199 AA
- Molecular weight
- N/A Da
- Isoelectric point
- 6,62699
- Sequence
-
KEYVFIHHTAGWHNPYNCIDSWGRDSRGAVATEFVLGGQSVKGNDTKYDGEMVHAFPEGSYGWHLGKNGSQHMHTHSXAIEVCNFGYIKDGKTYAGTRVAEDQIVTLSQPFRGYKDWHRYSDKQIESLHKWILWISERDGIDVRKGLPDLIRKIGVSAFEFQEDAYYGRVKGLWTHTNTRKDKSDMFPQQELVDMLLSL
Other Proteins in cluster: phalp2_11040
| Total (incl. this protein): 132 | Avg length: 241,2 | Avg pI: 7,62 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7EhAU | 199 | 6,62699 |
| 12jMj | 288 | 8,98272 |
| 1AN85 | 338 | 9,02959 |
| 1B0qx | 138 | 6,46978 |
| 1CXvW | 230 | 8,64233 |
| 1GDBm | 283 | 8,89285 |
| 1IL5q | 229 | 8,68616 |
| 1LKVQ | 275 | 8,82922 |
| 1MUQn | 231 | 8,73851 |
| 1MoCx | 231 | 8,20459 |
| 1Mpoz | 229 | 8,42165 |
| 1NY2O | 231 | 6,26283 |
| 1NyBC | 224 | 8,31985 |
| 1OoC4 | 229 | 8,31579 |
| 1UtLY | 283 | 6,37309 |
| 1eBCc | 229 | 8,53383 |
| 1gmNZ | 229 | 8,71924 |
| 1gmlD | 229 | 8,46007 |
| 1iEaZ | 230 | 5,60861 |
| 1iUzj | 275 | 6,65462 |
| 1jvjR | 229 | 8,55001 |
| 1n6LW | 174 | 6,23259 |
| 1oIWo | 231 | 8,71672 |
| 1pACo | 234 | 8,36472 |
| 1pkZ1 | 252 | 9,28946 |
| 1plxe | 276 | 7,70830 |
| 1prMw | 276 | 7,70495 |
| 1sCBP | 167 | 5,71393 |
| 1uspC | 133 | 8,68191 |
| 1vBsG | 123 | 6,04974 |
| 1wxtK | 172 | 6,25368 |
| 22cOO | 207 | 7,87277 |
| 23kJD | 281 | 8,82542 |
| 2H8fb | 317 | 5,42900 |
| 2Hm2h | 231 | 8,37846 |
| 2IsFm | 307 | 7,73751 |
| 2JJRZ | 277 | 8,81394 |
| 2JWcX | 281 | 8,25784 |
| 2LcuN | 283 | 8,52996 |
| 2MVcO | 293 | 5,93435 |
| 2MXPV | 293 | 5,81545 |
| 2QFIp | 184 | 8,44963 |
| 2gfrY | 231 | 8,65135 |
| 2ju02 | 167 | 6,10800 |
| 2kTNh | 180 | 6,15296 |
| 2n43p | 276 | 8,83302 |
| 2nBag | 276 | 7,75747 |
| 2nBbF | 281 | 6,60028 |
| 2nEWy | 283 | 8,47542 |
| 2rSsJ | 174 | 6,08322 |
| 2rydm | 278 | 7,75263 |
| 2yBoL | 230 | 4,98867 |
| 32DVH | 280 | 5,71569 |
| 34jJx | 283 | 8,80137 |
| 3Q8OR | 230 | 8,53434 |
| 3Qsh8 | 174 | 7,23773 |
| 3mRmT | 214 | 6,77358 |
| 3oiG2 | 198 | 8,58205 |
| 3rN3m | 179 | 7,71376 |
| 4AmNI | 229 | 6,31171 |
| 4BHUL | 276 | 8,99832 |
| 4D0ID | 224 | 7,73348 |
| 4NA9m | 276 | 6,54498 |
| 4PF8S | 283 | 8,52996 |
| 4WbMV | 148 | 7,91506 |
| 4Wcpl | 231 | 8,65142 |
| 4gvzF | 231 | 8,54885 |
| 4nXQY | 283 | 9,02443 |
| 4ne9J | 178 | 6,40862 |
| 4sWGJ | 293 | 5,81033 |
| 4soJZ | 277 | 8,68346 |
| 4sp0A | 231 | 8,45343 |
| 4tjk4 | 230 | 8,67243 |
| 4uNH2 | 279 | 9,43123 |
| 4vyAn | 280 | 6,72180 |
| 4vzQX | 182 | 6,71981 |
| 4xVf6 | 197 | 7,85104 |
| 4zC0u | 230 | 9,09741 |
| 56elA | 153 | 7,67084 |
| 588sa | 221 | 8,82258 |
| 5AZdo | 180 | 8,67147 |
| 5IxLS | 199 | 9,17612 |
| 5bviN | 210 | 5,59872 |
| 5gK72 | 229 | 8,50617 |
| 5h6lR | 276 | 7,80856 |
| 5uVfo | 218 | 9,08123 |
| 5uahz | 283 | 9,14724 |
| 5zK2A | 275 | 8,52428 |
| 6QUHW | 283 | 8,52996 |
| 7FORW | 228 | 6,69765 |
| 7GrVi | 281 | 7,15509 |
| 7IPzE | 278 | 8,56425 |
| 7L1oV | 306 | 6,25709 |
| 7L1u2 | 280 | 8,85165 |
| 7T0t8 | 278 | 8,56425 |
| 7UpvU | 283 | 8,53002 |
| 7UqW0 | 230 | 4,99918 |
| 7UtJB | 212 | 8,21374 |
| 7VgXA | 278 | 9,07800 |
| 8AUaq | 285 | 6,26294 |
| 8B1xo | 230 | 5,17663 |
| 8BstC | 283 | 6,26436 |
| 8CK8o | 245 | 6,45170 |
| 8CNkO | 285 | 6,20548 |
| 8Dfmt | 283 | 7,15554 |
| 8F8Ik | 181 | 9,00335 |
| 8FUoy | 283 | 8,71911 |
| 8GmVG | 215 | 9,06749 |
| 8bbVw | 280 | 6,56345 |
| 8grMz | 283 | 7,74621 |
| 8j87c | 276 | 7,07864 |
| 8mc5P | 178 | 8,43989 |
| 8nxWh | 229 | 7,76434 |
| 8p6Ru | 283 | 8,86004 |
| 8wHMi | 289 | 6,41942 |
| 8wSye | 281 | 6,55703 |
| 8xmPh | 230 | 5,08853 |
| 8z1xc | 285 | 6,36991 |
| 8zeGi | 285 | 6,20809 |
| 8zoOu | 230 | 4,99918 |
| 9FAk | 278 | 9,17039 |
| EuY | 280 | 7,70836 |
| IHJL | 229 | 7,74456 |
| RDrx | 178 | 6,77000 |
| TmAn | 229 | 8,49908 |
| Y09S | 180 | 6,07037 |
| ZRg2 | 276 | 7,11604 |
| dcpM | 164 | 7,08614 |
| k2Gk | 160 | 8,61634 |
| tdwk | 228 | 6,30085 |
| th08 | 195 | 9,44322 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_28209
iKDC
|
1185 | 68,8% | 209 | 1.961E-104 |
| 2 |
phalp2_35105
5kI8h
|
32 | 43,3% | 210 | 1.015E-74 |
| 3 |
phalp2_14005
87m9T
|
1656 | 33,3% | 207 | 2.259E-66 |
| 4 |
phalp2_4134
1HOCY
|
3 | 30,6% | 212 | 4.012E-59 |
| 5 |
phalp2_16476
6Lmyy
|
2 | 57,6% | 125 | 1.439E-55 |
| 6 |
phalp2_28796
7G1A0
|
2 | 23,0% | 260 | 2.512E-48 |
| 7 |
phalp2_33891
1NRwq
|
35 | 24,0% | 204 | 2.293E-38 |
| 8 |
phalp2_11814
8vJeI
|
1 | 26,7% | 217 | 2.821E-37 |
| 9 |
phalp2_13122
8iXkc
|
2 | 24,5% | 216 | 1.853E-36 |
| 10 |
phalp2_9246
6Vxs8
|
22 | 25,3% | 201 | 1.073E-31 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7EhAU)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50