Protein
- Protein accession
- 4dh7R [EnVhog]
- Representative
- 543gw
- Source
- EnVhog (cluster: phalp2_6086)
- Protein name
- 4dh7R
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MSTRLYITLGTAIFVGNIIYAQYEDHRISSIENSVSQIGSDIKEIKEAVLEQQPTAIKYNEKDIECLARNVYYEAGVEPLMGKYAVANVTINRVKSGYWGRHVCDVVYAKDQFSWTREKKRAWVELKGEAWATSRAVAESALKQHIAVKQLKHALFYHADYVNPTWRDRSKQVLKVGQHIFYTQAKGSNLSI
- Physico‐chemical
properties -
protein length: 192 AA molecular weight: 21959,8 Da isoelectric point: 9,19 hydropathy: -0,37
Representative Protein Details
- Accession
- 543gw
- Protein name
- 543gw
- Sequence length
- 196 AA
- Molecular weight
- 22440,44430 Da
- Isoelectric point
- 9,24175
- Sequence
-
MTLNQKYLAAGVAIFVAQVLYHQWITDERIAVIEDAVVAIAEDVQDIKQAVIVEQDRAVIKYSKQEFDCLARNIYYEAGVEDKLGKIAVAQVTLNRSRTGYWGRDICKVVYAPAQFSWTRVKRRAWLQNTGANWVESRQVAAEVLDQGIRIPTLKTSLFYHADYIKDPYWADHTKRTTKVGRHIFYTQAKGGTLKL
Other Proteins in cluster: phalp2_6086
| Total (incl. this protein): 128 | Avg length: 197,1 | Avg pI: 9,21 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 543gw | 196 | 9,24175 |
| 12H6Z | 175 | 9,43716 |
| 12LHX | 183 | 8,47703 |
| 14tju | 178 | 7,00793 |
| 165YR | 225 | 9,30023 |
| 17Tfd | 189 | 9,37681 |
| 18vFG | 175 | 9,42645 |
| 18x0u | 196 | 9,62128 |
| 1AE9K | 194 | 9,64848 |
| 1AJC4 | 174 | 9,43174 |
| 1LFmI | 217 | 9,44238 |
| 1NW9v | 172 | 9,71089 |
| 1OdB7 | 178 | 9,08019 |
| 1YThn | 179 | 9,21977 |
| 1hEzF | 181 | 9,28172 |
| 1hqyy | 233 | 9,56442 |
| 1iNmb | 175 | 9,39364 |
| 1ioLS | 198 | 9,06698 |
| 1q2Iz | 211 | 7,02117 |
| 1r3H0 | 229 | 9,35277 |
| 1roqt | 194 | 9,83370 |
| 1rpln | 193 | 9,67827 |
| 20cpv | 175 | 9,38249 |
| 25DJE | 170 | 9,11198 |
| 2DN3q | 192 | 9,26548 |
| 2Dw1z | 197 | 8,47264 |
| 2EEyl | 178 | 9,42136 |
| 2FhCz | 207 | 9,91267 |
| 2LvSo | 178 | 9,57615 |
| 2Nxdt | 215 | 9,40138 |
| 2bDu9 | 181 | 9,45037 |
| 2bE8c | 191 | 8,71930 |
| 2bHa2 | 215 | 9,46797 |
| 2bKDy | 179 | 9,27263 |
| 2bx7J | 187 | 9,74267 |
| 2j4fm | 226 | 9,53160 |
| 2jgk0 | 222 | 9,64881 |
| 2xdtg | 199 | 8,87325 |
| 30Xdb | 175 | 9,36979 |
| 30ipz | 175 | 9,56126 |
| 31It3 | 226 | 9,57015 |
| 329b6 | 222 | 7,77332 |
| 36WC5 | 184 | 8,81420 |
| 37IVa | 207 | 8,75772 |
| 3RNx4 | 208 | 6,44335 |
| 3b3DU | 169 | 10,09499 |
| 3b71d | 176 | 9,42143 |
| 462yi | 183 | 9,01250 |
| 46HXQ | 188 | 9,59742 |
| 46z3e | 175 | 9,34110 |
| 47oNY | 175 | 9,25568 |
| 48060 | 179 | 8,55400 |
| 48YSF | 172 | 9,03545 |
| 4961f | 176 | 9,38294 |
| 4FFNB | 200 | 9,62927 |
| 4V8Pz | 189 | 9,65338 |
| 4aSvp | 207 | 7,68238 |
| 4d2bm | 213 | 9,30100 |
| 4d5xm | 178 | 8,87241 |
| 4dfud | 174 | 9,35973 |
| 4dmXB | 192 | 9,39390 |
| 4fy4Z | 194 | 9,59710 |
| 4nCpP | 189 | 9,58705 |
| 4xRGg | 180 | 7,97076 |
| 501ll | 190 | 5,35602 |
| 501vK | 197 | 9,60877 |
| 52DTY | 204 | 9,71431 |
| 59nEP | 227 | 9,42568 |
| 59xP5 | 217 | 9,08142 |
| 5a33p | 192 | 9,50066 |
| 5bRV9 | 177 | 9,51839 |
| 5gEle | 202 | 9,51516 |
| 5gr8I | 189 | 9,73616 |
| 5gtXi | 189 | 9,53515 |
| 5kORw | 178 | 9,24311 |
| 5kYaS | 164 | 8,44634 |
| 5o8LZ | 189 | 9,67285 |
| 5ouZN | 172 | 9,73706 |
| 5thHh | 224 | 9,56912 |
| 6AEX8 | 220 | 9,71527 |
| 6KWhb | 184 | 9,45321 |
| 6LMkD | 224 | 9,44218 |
| 6M1A7 | 186 | 9,65925 |
| 6QvWH | 207 | 9,72630 |
| 6yAh6 | 189 | 9,56835 |
| 7F1Kj | 189 | 9,71598 |
| 7K3yC | 213 | 9,39274 |
| 7L6pI | 178 | 9,26135 |
| 7M3UP | 179 | 9,22499 |
| 7TuI2 | 232 | 9,76833 |
| 7WoG1 | 279 | 9,57905 |
| 80LQA | 209 | 9,44992 |
| 82QDq | 230 | 9,89566 |
| 82kSL | 222 | 9,76214 |
| 84ttJ | 222 | 9,87277 |
| 87u1d | 171 | 8,35518 |
| 891Qw | 212 | 5,95953 |
| 8Djr9 | 199 | 8,68081 |
| 8E9sO | 231 | 9,87303 |
| 8EOxZ | 196 | 8,37207 |
| 8EaP6 | 221 | 9,39467 |
| 8Ghlt | 232 | 9,76833 |
| 8GwU | 192 | 9,58808 |
| 8Ldv | 211 | 9,77761 |
| 8hGcj | 234 | 10,06018 |
| 8kF4M | 231 | 9,90204 |
| 8mDFt | 193 | 9,03919 |
| 8pxcV | 209 | 9,29913 |
| 8tjED | 224 | 8,82303 |
| 8wHtf | 199 | 8,87325 |
| 8x57I | 221 | 9,33775 |
| 8xp5L | 231 | 9,90204 |
| 8y1WA | 234 | 9,99913 |
| 8yEY6 | 142 | 5,24541 |
| 8zBth | 222 | 9,76801 |
| Iy3u | 178 | 9,33149 |
| RLZp | 209 | 9,84215 |
| RU9G | 171 | 8,44015 |
| SEdp | 186 | 9,33323 |
| TGQK | 173 | 9,02598 |
| THXH | 176 | 9,49408 |
| XCmn | 164 | 9,61103 |
| bCFl | 169 | 9,41994 |
| mxq0 | 182 | 8,97363 |
| A0A7D7F283 | 226 | 9,53431 |
| A0A7D7F4C8 | 232 | 9,54514 |
| A0A7D7FP48 | 223 | 9,71276 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_13600
5lmUm
|
9 | 37,6% | 199 | 5.333E-60 |
| 2 |
phalp2_15462
87Yrl
|
67 | 43,0% | 158 | 6.624E-59 |
| 3 |
phalp2_15984
7KpQ6
|
448 | 42,3% | 137 | 2.516E-40 |
| 4 |
phalp2_21419
85EIE
|
1722 | 43,8% | 130 | 4.248E-39 |
| 5 |
phalp2_3334
38dW3
|
10 | 42,2% | 142 | 3.804E-35 |
| 6 |
phalp2_9879
2oYX8
|
442 | 34,8% | 155 | 3.804E-35 |
| 7 |
phalp2_2416
54zSE
|
377 | 39,3% | 127 | 5.205E-35 |
| 8 |
phalp2_4108
1zenp
|
45 | 32,2% | 186 | 3.415E-34 |
| 9 |
phalp2_19867
5DmT3
|
416 | 41,1% | 124 | 1.197E-33 |
| 10 |
phalp2_38710
V6TC
|
7 | 31,8% | 135 | 1.197E-33 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(543gw)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50