Protein

Protein accession
4dQsg [EnVhog]
Representative
1mogV
Source
EnVhog (cluster: phalp2_23833)
Protein name
4dQsg
Lysin probability
97%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MNNMKMSQNGLNLIETSEGCRTTAYQDSVGVWTIGYGHTSNVSPGETCTLQQAQEWLQQDVSGAEYVVNTVVKAPLNQNQFDALVDFVFNLGSGNFQSSTLLKLLNAGDYQGASNEFPKWNHAGGVVEPGLTTRRLAEQKLFNTPITLPTTTSAQTGATQSPTLVEQLQTWVQALQGKFSSK
Physico‐chemical
properties
protein length:182 AA
molecular weight:19777,8 Da
isoelectric point:5,06
hydropathy:-0,37
Representative Protein Details
Accession
1mogV
Protein name
1mogV
Sequence length
237 AA
Molecular weight
26481,34950 Da
Isoelectric point
8,19840
Sequence
MKRKLSNIGLALIKQFEGCRLSAYKCQSSEQYYTIGYGHYGADVTQGMVITQEQADNLLLKDCDKFVDHVNTYMDKYNFNQNQFDSLVSFAFNIGNINQLTNNGTRSISEISSKIPEYCNAGGKKLAGLVTRRNKEKELFDTPVSDKSITEIAQEVIAGKWGNGDERKANLANGGYDYTTVQNEVNAILNQNKKSVTEIAKEVIAGKWGNGDERKSKLANAGYDYNTVQTEVNRLLK
Other Proteins in cluster: phalp2_23833
Total (incl. this protein): 302 Avg length: 220,8 Avg pI: 8,84

Protein ID Length (AA) pI
1mogV 237 8,19840
195FC 159 9,20107
197UO 155 9,41885
1NA6r 190 9,48370
1cMkf 155 9,34993
1dkJb 145 8,81768
1gBlW 233 9,29900
1gDCI 229 9,09670
1jBit 145 9,51890
1jF40 147 9,60826
1nvOv 227 4,56863
1o4pA 196 6,42033
21GIa 159 9,35825
21fcR 159 9,35799
232Tg 241 9,68839
2333k 163 9,67118
2363w 144 9,84718
23DGi 323 8,96886
23JQt 230 9,63243
23ShS 156 9,30087
23aDK 238 9,49266
23bsD 239 9,64926
23cjk 195 6,89533
23sqN 241 9,72675
24HKW 232 6,52878
24KKE 159 9,33846
24kGz 318 9,39061
24qu9 239 9,57518
24sxQ 209 9,64004
2VhTX 238 9,54940
2VlFT 233 8,75424
38JGB 156 9,47223
38KS5 239 9,42974
38jx2 150 9,41517
3LQh3 194 9,72507
3PBAz 238 9,67247
3VFJD 239 9,55391
3WHBU 198 9,32962
3WKyM 248 9,83003
3ZN19 235 9,22873
3ZOX5 242 9,85801
3Zxw9 144 9,51852
3e45Z 248 9,79650
3gcME 230 9,69638
3ifXL 156 9,47223
3ivQR 204 10,09460
3k9gU 235 8,60700
3o42V 230 9,56480
3pJpS 295 9,46546
3pLHf 203 10,08003
3qtKG 247 9,39815
3rWv8 203 10,08003
3tS3P 281 9,51452
3vEmp 227 5,10854
3wrZ0 193 10,00177
3wvrq 173 9,63578
3xIUd 183 9,65951
3y5V0 237 9,83209
3yUVE 228 5,55467
3yzMZ 304 9,35019
40la5 158 9,05557
40leY 227 9,63378
41cD2 159 9,40221
41cD3 142 9,42400
41hE9 241 9,64719
41ktk 144 8,58289
41oax 159 9,40686
4DCjN 240 9,50646
4JZOs 242 9,92841
4JZS0 155 9,34993
4L9QI 169 9,21345
4LdYm 235 9,75254
4MfaZ 290 8,00357
4Ufgo 156 9,39022
4ljOm 151 9,43812
4y2qh 221 8,55620
4y5gI 217 9,02978
4y6aJ 217 8,83554
4ylSW 245 4,96207
4ypcg 245 5,03977
4ytci 240 9,62540
5LxDh 304 9,34181
5Lyxd 244 4,65860
5MIt0 304 9,27605
5Mdgj 242 9,90674
5NG0V 194 9,66924
5NTqw 211 9,54404
5NaUM 197 8,74199
5NgE0 250 9,44244
5NjBx 293 4,87522
5NoaC 242 9,90674
5OIgi 246 8,99220
5OLty 228 5,62163
5Of5Y 246 8,76159
5Ot2C 293 4,62081
5Qq8t 196 6,08458
5RqIE 304 9,29462
5SLsf 242 9,91480
5TMDh 242 9,27657
5Uck7 246 8,55123
5Uhff 197 8,42984
5V15j 222 8,88576
5VFn8 251 9,42620
5WO2E 242 9,89520
5XkZQ 197 8,41714
5XzgJ 190 8,77597
5YMnI 241 9,13312
5YVT5 145 9,31731
5YVou 242 9,98327
5YZxJ 238 9,79244
5dq2s 151 9,51690
5fJS7 150 9,63669
5hTo4 227 9,30068
5hZZG 227 9,36489
5i2mH 227 9,30068
5jDhK 217 8,72033
5jHJl 191 9,67008
5jo5O 217 8,63079
5mNsR 150 9,54198
5nKYD 196 4,99810
5nOLx 201 9,36689
5xmYf 150 9,63669
5ync4 150 9,43812
605UH 238 9,89243
608kY 197 8,76959
61Jk7 246 9,21584
62It1 242 9,94717
634ZA 242 9,92699
64Nbl 231 7,67170
64NcO 197 8,41714
64n3q 194 9,56687
65QU7 237 9,82403
665ib 242 9,93053
66KH4 197 8,76939
66Us 251 9,15756
670ey 242 10,01847
67EkN 211 9,53128
67MGR 242 9,89043
67xeZ 197 6,08725
68HZ 228 9,61012
68sS4 237 8,98001
699uT 242 9,89959
69Rqs 251 9,35257
6HJ6H 145 9,71553
6XE6b 146 4,62530
6YBCe 228 6,62699
6YfKc 229 7,68460
6ZK9y 228 8,61112
6amn4 197 8,53080
6aqDf 246 8,93727
6aqDo 197 7,71046
6bjqI 295 9,38577
6d1IX 231 7,67187
6dOjx 197 8,42829
6dTeg 197 6,90352
6dhQL 246 7,78058
6diZq 242 9,84240
6drve 242 9,89520
6eB0t 197 8,42823
6eEcN 197 7,72910
6eZlr 246 9,13274
6efRL 194 9,30139
6f7ui 242 9,89520
6fctc 193 9,65570
6fgGU 242 9,85923
6fmUq 194 9,66950
6ftlo 247 9,38816
6gBSN 242 9,96257
6gRXa 197 8,75579
6gf82 197 8,42829
6hRqZ 194 9,65177
6hdU8 238 9,89243
6hjh2 246 8,68429
6iEEI 194 9,77910
6iEVx 211 9,49118
6iTmT 147 9,31718
6id5u 240 9,87631
6iuLD 231 8,54885
6jfiy 246 9,02443
6jhhG 293 4,71038
6kCnT 246 8,28072
6kSt1 237 9,81359
6km4m 242 9,90707
6ktge 197 7,75087
6l7kk 242 9,91093
6l8xa 205 10,06024
6lfdb 242 9,87438
6mPwb 298 9,49189
6mbHF 241 8,88776
6mnQg 241 9,16690
6muUJ 235 8,82426
6nSVy 242 9,93085
6o09P 231 7,66811
6oDRn 242 9,94962
6pI7F 251 9,50936
6pVkO 242 9,92757
6pWMP 242 9,85291
6pbGM 247 9,33639
6prux 197 8,42829
6py72 246 8,99220
6qnJO 231 8,54059
6sLxi 242 9,86503
6smqt 231 6,43766
6tCGf 196 6,90164
6tbup 304 9,35857
6teNa 197 7,79818
6uCBa 193 9,65570
6upkP 194 9,66950
6vBRJ 211 9,62276
6vwcQ 241 8,79789
6wEw0 231 8,30877
6wdiI 241 8,87834
71jEE 231 9,60194
7AHAL 208 8,40631
7AHAc 219 8,62666
7AHBX 219 8,62666
7AHBl 241 8,90439
7AHEW 219 8,30677
7AHEl 219 8,32572
7AHIC 208 7,72859
7AHPr 217 8,70422
7AHQ2 217 8,74670
7AHRT 241 8,94623
7AHT7 231 8,60635
7Mzle 229 6,91119
7N6Fs 243 10,00055
7NJdd 229 8,30490
7PPFR 231 8,98182
7PPGA 241 9,11011
7V06a 306 9,10566
7WDH3 145 9,35941
7XzzR 215 8,92483
7YhKf 149 9,87748
7YxYr 232 8,25345
7q3AX 158 9,48641
7q3S6 158 9,27289
7vVz9 309 9,34013
7wCQ1 208 8,42358
7xAjz 216 9,84434
7xAk0 224 8,82825
80qIe 190 9,43612
82B9Y 241 8,80285
84TT7 306 8,83554
85j3S 242 9,85949
85vaL 231 8,30883
86Ors 228 5,98329
86fKl 194 9,61103
89Uc8 242 9,78599
8HieS 231 8,60713
8HieW 217 8,61615
8LKZg 226 8,98182
8MDtP 241 9,17812
8MLNT 246 8,83483
8MLOt 208 7,72888
8MLP7 208 7,78522
8MLPF 241 8,95783
8MLQg 235 9,12345
8MLRx 208 6,42794
8MM1U 203 6,90227
8MM1l 241 8,60713
8MM2w 183 8,69287
8MutU 231 8,62647
8Mutj 219 8,64735
8aVpA 208 8,62672
8b6NY 145 9,63475
8beLi 230 9,08387
8beNd 194 9,19817
8bsqs 196 9,63340
8bzKy 269 9,46552
8dW9V 306 8,94771
8fzIg 324 9,09702
8gjJq 208 8,41849
8hQxn 241 9,10811
8hcZS 145 9,82319
8icr4 230 8,41681
8kSed 219 8,39573
8lgsY 190 9,63211
8lusN 228 9,40711
8mPM0 228 6,63785
8mpI4 308 8,94784
8mpbH 308 8,83554
8nXWS 145 9,55371
8qUUh 243 9,89520
8r4ru 246 8,22670
8rDcq 306 9,05035
8rnLV 211 9,51677
8rxXs 203 6,90227
8s1MA 311 9,16181
8sqWR 208 8,93914
8tplj 208 7,72421
8v5Wu 235 8,80272
DSUT 229 7,68039
N92a 228 8,32121
NJxz 229 8,30490
Yu3N 231 8,30877
a4wx 284 9,39596
e6ZL 208 7,88882
mDjV 158 7,00475
nMZl 179 5,34709
oKGr 235 8,58785
wSxL 228 6,62699
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_17145
2TusA
116 60,1% 148 1.230E-72
2 phalp2_18435
6pVoD
1 58,6% 167 6.707E-67
3 phalp2_10187
xiY3
70 48,3% 178 9.185E-67
4 phalp2_40316
3fQk2
50 56,3% 149 7.490E-65
5 phalp2_33932
23JqA
85 56,0% 150 3.606E-64
6 phalp2_34307
3A2Hz
178 44,9% 167 2.154E-59
7 phalp2_33221
5jbqV
447 45,4% 154 1.571E-53
8 phalp2_16385
5LDDR
25 52,3% 149 5.510E-53
9 phalp2_28113
7zmZV
50 35,4% 220 1.412E-52
10 phalp2_2632
6RhYr
14867 41,6% 149 4.908E-49

Domains

Domains
Representative sequence (used for alignment): 1mogV (237 AA)
Member sequence: 4dQsg (182 AA)
1 237 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959, PF08230

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1mogV) rather than this protein.
PDB ID
1mogV
Method AlphaFoldv2
Resolution 94.03
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50