Protein

Protein accession
4cn5L [EnVhog]
Representative
80F6A
Source
EnVhog (cluster: phalp2_9780)
Protein name
4cn5L
Lysin probability
99%
PhaLP type
endolysin
Probability: 97% (predicted by ML model)
Protein sequence
VAITGLNALVDACAKDELSDGDRKRTMVNGRHRLYKCPAGKWTIGYGRNLEDNGISDSEARTLLMNDVLAAQRDAASLIPNWLALDVVRQNVCANMAFNMGRATLSKFVHFLAAVDEMRYEDAADEMKASKWYGQVGQRAQRLEHEMRTGIVL
Physico‐chemical
properties
protein length:153 AA
molecular weight:17045,3 Da
isoelectric point:6,99
hydropathy:-0,31
Representative Protein Details
Accession
80F6A
Protein name
80F6A
Sequence length
193 AA
Molecular weight
22426,57290 Da
Isoelectric point
7,70233
Sequence
MDIGFNINRGDIGSVLGTFVEKIDDGWFKVGGVKVKCYTSNSGLLKNEITWDEHYEMNYTKIKDQLIKHEGLRLKPYKCTAGKLTIGVGRNLDDVGISEHEALDMLFNDIGKCMNDLREIFQQFDQFPENIQLVLVDMRFHLGPNRFRAFRAMIRAVDDRDWSEMIRQMKNSAWYLQVKNRANNLIEMVKNAK
Other Proteins in cluster: phalp2_9780
Total (incl. this protein): 154 Avg length: 145,9 Avg pI: 6,47

Protein ID Length (AA) pI
80F6A 193 7,70233
13KCg 137 5,21170
13OKz 145 4,88533
140Hb 137 4,87203
16uCQ 141 5,49186
1BIS2 188 6,75136
1Ctjx 140 8,39290
1GDaT 137 5,21204
1OYmR 146 8,92753
1PPF 140 9,24994
1TRbF 147 5,47646
1W0Zh 137 5,84483
1bbtl 139 6,90943
1egMO 137 5,04164
1kuf0 136 5,70637
1mCgU 179 6,60466
1muKc 139 6,05923
1pPB0 151 8,52815
1qGeW 140 6,30870
1rE5j 136 4,92774
1sATK 137 5,09888
1u7MC 137 6,30858
1uBMz 137 5,43105
1vib0 140 5,45316
1vvll 136 5,07535
1wt8y 139 5,11144
1yORR 136 4,82321
20ZEu 137 4,97792
21WWz 154 5,26246
224h8 137 5,44457
22gmy 137 4,96167
2A4Qx 157 9,29906
2BbEF 144 7,83292
2Bpqv 143 7,07324
2ChY5 142 7,87902
2J4Q7 136 4,94496
2PhPQ 139 5,38972
2Rg8Y 136 5,07228
2V6yX 149 10,06766
2aYIU 151 8,59694
2akge 218 4,65929
2eCE8 136 4,92984
2nLo9 139 5,20647
2nazM 120 5,47885
2q9zN 139 5,56962
2qUtM 137 5,22608
2rGab 142 6,21980
2sGja 157 9,25851
2sPa0 157 9,29906
2t8lz 156 9,13480
2tkKA 155 9,17483
2uAzG 207 5,45361
2wg4e 137 4,75011
2wxFk 146 7,07699
2xIkR 152 4,96275
34Ony 140 7,65152
3JqD3 149 8,73129
3Kb0C 152 4,88130
3P4ns 137 4,86413
3QKyB 160 6,13892
3RJrn 137 4,79172
3Rc2f 139 6,12846
3RqAt 106 5,16169
3T4bT 143 7,83415
3USOw 143 9,12764
3mEqt 205 5,06568
3rAbi 139 5,25206
3rGew 140 6,58545
3xG3Q 136 8,71627
40nhp 147 6,33183
47R5j 136 5,07535
48rqO 140 8,84817
4Bzdt 136 4,71624
4DmG8 156 9,27592
4K8iC 166 9,30061
4N8OM 142 9,07530
4N9SQ 141 6,50559
4Qo2U 140 7,94568
4Qp5s 139 6,19223
4RgsN 186 8,78390
4Rsvl 139 6,15682
4Uu91 137 7,84717
4i4Y0 151 7,02271
4iA2t 175 7,81507
4jOej 140 5,66937
4t4k2 137 6,15341
4x9qj 139 6,15682
4xBeq 139 5,40228
4xnLI 140 5,45316
4xswQ 145 8,93591
5AJpk 167 9,40486
5AhyU 136 4,82321
5B2zB 139 7,00293
5JFQ1 136 9,29990
5j2jy 136 5,31185
5qYMT 142 6,09686
5yKAu 139 4,97758
6B2iy 140 7,75013
6B3FL 137 5,05852
6B6lr 136 5,08893
6C9hJ 137 5,45418
6G3MB 136 4,94496
6JF9o 140 5,71069
6JWF7 140 5,71069
6Js8G 140 5,67960
6Pc71 196 6,89971
6yAiH 155 9,31834
77v3 216 5,56359
7CiLe 131 5,85143
7Dr48 145 5,11462
7U2bW 137 5,28537
7XE9Y 139 9,25471
7XRjh 143 9,17716
7XyR5 137 8,96196
7eaP3 139 5,62276
7ef0o 139 5,20125
7gCf 205 4,96929
7xbTs 139 6,13392
7xbW5 139 5,62276
86h9 142 5,82807
89Qic 140 6,58545
8AIAe 137 5,25041
8AMD 191 5,32493
8By4g 147 5,64317
8ChhO 142 5,56945
8DaIW 140 7,95638
8Fo6O 136 5,09962
8FtTU 147 5,65886
8GC2P 139 5,25001
8aFKc 167 9,35373
8cgWx 145 5,26638
8fPlW 146 9,22512
8gGG 144 9,06653
8h2wE 137 5,12070
8hoH0 147 5,48641
8n3vu 147 7,73319
8qSbj 166 9,06943
8srwH 148 6,83264
8wjrH 142 5,80482
8wsqm 139 4,57136
8xHnZ 142 5,56945
8xarh 139 4,68236
8yGlA 139 4,84333
8zFlE 139 5,16140
8ztGQ 139 5,06722
9xX3 143 8,40366
A6rE 141 8,60223
YYsb 142 7,70466
cfMC 140 5,71069
e2Yn 137 4,94712
i6kx 114 9,77200
seBQ 137 5,13281
tOla 143 4,90693
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_32797
2yPO8
5731 48,1% 137 1.577E-65
2 phalp2_17008
8jNgs
3526 41,7% 139 4.156E-62
3 phalp2_6283
6Psj3
6 47,3% 131 6.559E-57
4 phalp2_16834
1uDRT
24 44,1% 136 3.167E-56
5 phalp2_27968
RI1z
5083 39,5% 134 2.356E-53
6 phalp2_24213
2KXlJ
83 41,8% 148 2.134E-52
7 phalp2_8442
12q1i
28 45,2% 137 1.030E-51
8 phalp2_6928
2KMCh
358 38,3% 159 3.627E-51
9 phalp2_14448
4FjnP
18 35,9% 142 3.727E-45
10 phalp2_10326
1pOZW
1 48,6% 146 2.221E-43

Domains

Domains
Representative sequence (used for alignment): 80F6A (193 AA)
Member sequence: 4cn5L (153 AA)
1 193 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (80F6A) rather than this protein.
PDB ID
80F6A
Method AlphaFoldv2
Resolution 81.39
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50