Protein
- Protein accession
- 4Yjf7 [EnVhog]
- Representative
- 6UNCq
- Source
- EnVhog (cluster: phalp2_27725)
- Protein name
- 4Yjf7
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MAVAIREVFIAGYDGYPMAPKYITIHNTANESKGANAEMHARYLNNGAGGRTVSWHYTVDDREIIQHLPTNVNGWHAGDGANGTGNRQSIGIEICENVDGDFERAVANAIELVQYLMRKHNIGIMNVVPHQRWSGKYCPRKLLTRWDDLIKRIADTNVKSAVASKPSKAPVKPAAKPTAKPAPAPSKSTGKTLSLPASESSWRVYPVGKAPTKGNESGFLNPKKFGGLTYDILDNPAPDVYTIKTGDFGTVNIYAGKETGAKVSGAAPAKAKPKQYVQLPKSASSWRAYPLSKSPTKGNEVASLNPAKFGGLEYEVLRFSQPDVAVIKTQQFGEVQIYVAASTGAKLISK
- Physico‐chemical
properties -
protein length: 350 AA molecular weight: 37783,5 Da isoelectric point: 9,61 hydropathy: -0,43
Representative Protein Details
- Accession
- 6UNCq
- Protein name
- 6UNCq
- Sequence length
- 364 AA
- Molecular weight
- 39682,56980 Da
- Isoelectric point
- 9,53940
- Sequence
-
MVTIKKQHTKVNYSNINIPVKFIVIHDTGVPGQSAKNNADYFENTYRGASAHYFVDENEIIEVVAPGKKGWHVGDDKDDSDGINNGNTIGIEFCAEKDKTFKPETIANGQLLVRKLMKDYGVSANKVVRHYDASGKNCPQFMNIDGKWTLWKQYHKELTGAASVSVPLPSNSNKESQHIVKAGDTLWGLSKQYNATITELKKWNNLKSDIIVVGTKLNLGNNVKTPTPNPTPVASTPKATKSIQQLVNETNAGKHGNGDARKKSLGSSYDAVMKVINGGSKPASKPVTNKKRVYLPKSAKTWRVYKTSGPYTTGKEVGLLAPATYGGLDYEIIKTLATDVYEIKTSAFGNVAIYAAKSTGATIK
Other Proteins in cluster: phalp2_27725
| Total (incl. this protein): 90 | Avg length: 358,4 | Avg pI: 9,69 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 6UNCq | 364 | 9,53940 |
| 1cez3 | 410 | 9,22377 |
| 1cfxS | 437 | 9,93492 |
| 1cnC4 | 410 | 9,22357 |
| 1d8qI | 367 | 9,66544 |
| 1kHg0 | 315 | 9,73584 |
| 3LkV7 | 453 | 9,80417 |
| 4jR | 367 | 9,60065 |
| 4yV | 348 | 9,88321 |
| 5yh | 337 | 9,73300 |
| 71N3x | 367 | 9,59085 |
| 71UMX | 334 | 9,80933 |
| 72Aj1 | 453 | 9,77536 |
| 72obm | 359 | 9,78161 |
| 759sg | 355 | 9,79657 |
| 75AVG | 349 | 9,81443 |
| 75LtX | 303 | 9,67111 |
| 76lld | 279 | 9,78361 |
| 77t3b | 337 | 9,85627 |
| 78HZ8 | 348 | 9,88721 |
| 78P6X | 343 | 9,82745 |
| 7C2oi | 348 | 9,73629 |
| 7bcYu | 337 | 9,82358 |
| 7d29E | 365 | 9,62399 |
| 7dCxB | 453 | 9,72597 |
| 7dDkU | 337 | 9,75118 |
| 7dDoM | 460 | 9,79392 |
| 7dRC2 | 336 | 9,79018 |
| 7dfif | 336 | 9,75595 |
| 7dfj8 | 337 | 9,85652 |
| 7dgOp | 303 | 9,66318 |
| 7dgPc | 337 | 9,78999 |
| 7duQ7 | 337 | 9,85627 |
| 7duVu | 336 | 9,90694 |
| 7f2mo | 367 | 9,66956 |
| 7f8Lc | 337 | 9,76833 |
| 7fJms | 349 | 9,83370 |
| 7fNng | 337 | 9,87000 |
| 7fnKx | 367 | 9,64262 |
| 7g57s | 450 | 9,75131 |
| 7gIxN | 367 | 9,66518 |
| 7hWr8 | 351 | 9,69690 |
| 7hj1T | 348 | 9,82506 |
| 7hq9u | 312 | 9,77806 |
| 7kTqp | 453 | 9,74112 |
| 7knAu | 337 | 9,79018 |
| 7knHq | 349 | 9,67820 |
| 7kq9V | 348 | 9,80888 |
| 7l0oj | 348 | 9,74802 |
| 7l8sU | 348 | 9,74783 |
| 7lzsD | 351 | 9,74138 |
| 7nHqP | 410 | 9,30912 |
| 7p6A3 | 367 | 9,66544 |
| 7pZ2Q | 348 | 9,85214 |
| 7pwcK | 363 | 8,92515 |
| 7qDFn | 335 | 9,74873 |
| 7qyTg | 337 | 9,81004 |
| 7rUUd | 419 | 9,12519 |
| 7sWrw | 410 | 9,32447 |
| 7u5AB | 338 | 9,90017 |
| 7u5H7 | 300 | 9,70425 |
| 7u5J0 | 336 | 9,77748 |
| 7u5X5 | 383 | 9,57447 |
| 7u6b4 | 303 | 9,66318 |
| 7u6d3 | 337 | 9,81049 |
| 7uMSS | 347 | 9,88631 |
| 7uN7t | 337 | 9,84298 |
| 7um0D | 348 | 9,72449 |
| 7v1xm | 336 | 9,87548 |
| 7vB3Y | 410 | 9,20675 |
| 7vfTV | 337 | 9,84318 |
| 7vt1E | 311 | 9,68420 |
| 7vttp | 336 | 9,82358 |
| 7w1fd | 337 | 9,73319 |
| 7wl8y | 410 | 9,12751 |
| 7wlac | 410 | 9,33285 |
| 7wt3w | 337 | 9,78980 |
| 7wtch | 367 | 9,60065 |
| 7x5iw | 347 | 9,77375 |
| 7xsxv | 336 | 9,90371 |
| 7yCM9 | 300 | 9,58924 |
| 7yCNd | 337 | 9,84318 |
| 7yTR2 | 367 | 9,60574 |
| 7yU3Z | 367 | 9,61883 |
| 82Ulr | 410 | 9,23956 |
| 8JpFN | 367 | 9,62534 |
| 8KbsS | 300 | 9,65538 |
| CFUo | 457 | 9,80205 |
| bhu | 336 | 9,74918 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_22268
7qxva
|
11 | 35,9% | 253 | 6.910E-61 |
| 2 |
phalp2_29156
7qyOK
|
47 | 29,2% | 250 | 4.322E-55 |
| 3 |
phalp2_11417
eYHn
|
21 | 29,7% | 252 | 1.260E-40 |
| 4 |
phalp2_14834
7s5S0
|
47 | 25,9% | 277 | 1.260E-40 |
| 5 |
phalp2_3935
78x1H
|
58 | 29,2% | 270 | 6.745E-39 |
| 6 |
phalp2_13856
7rXAX
|
3 | 23,9% | 384 | 1.573E-29 |
| 7 |
phalp2_8205
7kqpf
|
6 | 23,4% | 252 | 1.390E-24 |
| 8 |
phalp2_30830
8H1gU
|
43 | 22,8% | 380 | 6.157E-24 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(6UNCq)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50