Protein

Protein accession
4SzQe [EnVhog]
Representative
4hIyC
Source
EnVhog (cluster: phalp2_31569)
Protein name
4SzQe
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKKIKEKHIKDFDNIIKIVLKHEGKYVNDPNDAGGETNFGISKRSYPDVDIKNLTKSDAISIYKRDYWDRYKVESLPKELWHIYFDMCIHMGNSRAVKILQKSAVNRGRKIKIDGRLGRNTRRALNGVSVNRVRAFRVRYYVELVNKKPRNEKFYYGWFRRALEV
Physico‐chemical
properties
protein length:165 AA
molecular weight:19627,5 Da
isoelectric point:10,08
hydropathy:-0,78
Representative Protein Details
Accession
4hIyC
Protein name
4hIyC
Sequence length
114 AA
Molecular weight
13582,30110 Da
Isoelectric point
8,44583
Sequence
MKNDFDKAIKFVLKWEGGYSNDPNDPGGETNFGISKRSYPELDISKLTLKQAKEIYYQNYWLKCGCDELPYPFNIVVFDTAVNMGRRRAMEFLDAYNDWRDYLLKRLYTYSKFK
Other Proteins in cluster: phalp2_31569
Total (incl. this protein): 214 Avg length: 150,5 Avg pI: 7,35

Protein ID Length (AA) pI
4hIyC 114 8,44583
11gS6 190 9,69664
12119 180 8,61731
12h2J 171 8,69197
12i1s 156 6,75306
12mwk 99 8,66760
16xyn 194 9,21500
17os5 103 8,42726
17rC4 164 8,60603
1A6k6 157 6,75073
1DTg9 157 6,51070
1DfJM 141 4,73335
1Dlul 141 4,61740
1HYHb 154 7,86877
1KChG 163 9,25355
1KSVz 115 6,07492
1LDKM 146 6,90028
1LImy 154 7,88398
1LgBg 160 6,71765
1Ogcj 156 7,77793
1OtPm 154 7,67408
1Y6oF 156 7,77793
1YaGd 79 5,27218
1Z2TQ 173 9,13164
1ZuYp 149 8,79982
1dXvX 159 5,23768
1fTeF 195 6,12687
1g591 181 8,94649
1gxVC 96 8,88602
1iUe4 143 5,32203
1j4Sj 155 5,00572
1l23C 145 5,45281
1l3q4 142 8,41250
1lCUJ 141 5,65124
1lLTG 147 8,96138
1sGje 206 8,60422
1wUX8 157 6,72163
1xXgR 181 9,63449
20HJp 127 6,05895
24REG 155 6,43641
26L70 145 9,13951
29qNU 185 9,09489
2B4dq 165 9,60084
2FDDr 144 9,17238
2GGGc 154 9,25000
2I64E 158 7,72933
2aSdq 147 9,68401
2djBT 149 7,79592
2mG08 193 8,97421
2nAxv 150 7,70313
2rMhX 165 9,40847
2tzXs 153 6,19382
2vnbP 157 9,96425
2wDCO 167 9,17728
2wLuC 137 8,55832
2ydol 165 10,10157
2ydr9 157 8,85288
2zsKJ 157 7,78283
2zuYr 156 6,74948
2zziF 181 9,57409
2zzuc 181 9,51942
34E2v 166 5,06307
35LFN 144 5,47146
39ZIz 155 8,26570
39ZyR 151 6,14364
3ANy3 121 8,47722
3BEzx 110 7,77832
3C6pm 111 9,18534
3CCFr 160 8,30670
3CW4j 157 9,15917
3ERDG 160 8,29039
3Ep0I 157 8,54382
3G36a 157 9,00857
3H4oQ 158 8,43229
3Hlbg 157 9,26374
3Hun2 157 8,93843
3HyVk 157 9,15917
3K7tI 109 8,68752
3Kn4Z 156 7,77793
3PlkZ 150 6,39157
3QdY0 148 8,32031
3S2Ak 153 6,82781
3T9oc 154 9,33968
3Tbv4 130 5,64561
3UTHl 159 8,88653
3WXfo 135 5,12332
3aT0l 157 9,95587
3de75 144 7,81436
3e37o 177 8,70783
3iSye 161 6,69679
3jqTw 181 8,44247
3moL 133 8,75843
3nfs0 142 6,58039
3oMZG 157 8,83696
3rMzA 102 8,53234
41yk8 143 5,49840
42kZ6 138 5,01891
453BC 103 6,01291
45G8o 145 5,71507
4DwsR 143 5,83869
4Felu 139 9,17200
4Fzlf 150 8,47503
4GzV0 150 6,71941
4HeBL 145 5,86950
4Hh1C 136 6,71589
4HxBt 145 5,07592
4IFnH 156 6,55879
4K6Of 144 8,45047
4KIJI 133 7,68244
4KYjB 158 8,70834
4KhW1 141 8,58824
4LM2f 162 8,76507
4Lhjf 159 5,24137
4MV2E 155 8,75927
4Mq9P 148 5,46532
4PRs2 156 8,54124
4PbjR 160 9,08419
4QW1x 153 6,45159
4RjWd 145 6,82229
4RkeK 144 8,44860
4SIeT 146 6,91375
4ThKI 146 6,29244
4UhT7 155 9,14054
4Zfs8 149 6,11414
4c2Sj 145 8,69977
4cqvl 139 7,66840
4hEAc 152 9,51845
4jr1s 138 5,68387
4jsFe 141 4,95547
4kBKG 146 5,38682
4kI5H 145 6,46921
4ku8Y 161 5,80414
4urDD 151 6,07782
4wKPM 144 7,79895
4wTHs 167 5,12161
4xeRA 157 10,06501
4xiGT 170 8,63291
4xjlC 168 7,73024
4xmCz 169 5,50874
5BbAJ 138 5,22671
5D60g 154 7,87141
5DlNC 123 6,31671
5EAdx 132 5,71410
5EbM3 154 7,73251
5H5oI 161 5,80414
5Hd1F 182 5,59645
5IFVa 138 5,75338
5LgFq 160 6,35485
5ngUv 146 8,24842
5ocLO 143 5,55632
5r1oN 125 4,90972
5rDGe 156 6,56743
5sX42 105 4,68714
6FNgE 133 6,40475
6FwsS 146 5,90940
6FyWl 146 5,14725
6G0eT 146 6,40822
6IdeT 115 5,60992
6Iq02 137 5,10797
6J4pq 180 4,74125
6M0Lu 131 8,69190
6MV0T 146 5,86666
6MV9x 146 6,10618
6QfIM 138 6,90528
6VXxs 181 9,37565
6VagV 160 5,40291
6XXdQ 130 5,43127
6Xezo 144 5,66210
78iVt 175 6,11993
7DVdE 146 6,28420
7SqMc 87 4,79110
7VNwA 158 9,06627
7VPyF 156 7,77793
7Wvt7 158 9,02404
7WvwF 178 8,35286
7ZsWA 148 6,50996
7ZtSa 154 5,61003
7nF7d 153 6,17865
7vCsL 181 9,44167
80YOf 154 5,63248
83BtP 130 10,28801
83tcX 160 8,60667
89GA6 143 6,32882
8A2xB 157 6,90903
8AkZH 157 8,29465
8BnLZ 159 5,34692
8CSu8 157 8,59675
8DYmb 157 7,62554
8E4Mp 141 5,73957
8G5Nw 149 8,98465
8Gnnq 107 6,73385
8aN4w 145 6,58976
8hUSh 158 8,70415
8j0p0 145 6,58942
8pp37 173 5,26167
8r2ud 160 5,76134
8yO6p 106 8,51751
8z3XB 194 8,93785
8zZIi 161 6,16728
8zn9V 157 8,60616
8zxMx 157 8,60597
D2g5 141 9,48286
QSsj 189 4,44171
Tfl7 153 5,35676
TsFM 110 8,50449
VOaO 153 7,67431
X5CM 194 6,19934
Y5xJ 142 5,41155
YIRs 169 6,29926
YkNi 137 6,81746
hIcG 151 4,88664
uiov 137 5,85535
A0A6J5N5C0 158 9,22705
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_38550
1LK0Y
12 64,1% 78 4.747E-37
2 phalp2_37851
4LyyS
5845 44,6% 103 1.538E-35
3 phalp2_6321
72lJ7
149 47,0% 102 2.110E-35
4 phalp2_33765
15NtY
387 48,0% 102 3.321E-33
5 phalp2_32911
3ACsn
4 51,8% 81 9.842E-31
6 phalp2_40381
3TbBc
289 47,5% 103 1.296E-26
7 phalp2_11557
12S8B
2 41,7% 91 1.243E-22
8 phalp2_29127
77Hso
2 47,8% 71 3.209E-22
9 phalp2_23510
6Y4uI
354 35,4% 110 6.038E-22
10 phalp2_3878
6ORZl
656 39,4% 109 8.282E-22

Domains

Domains
Representative sequence (used for alignment): 4hIyC (114 AA)
Member sequence: 4SzQe (165 AA)
1 114 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF05838

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4hIyC) rather than this protein.
PDB ID
4hIyC
Method AlphaFoldv2
Resolution 90.10
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50