Protein
- Protein accession
- 4RzbJ [EnVhog]
- Representative
- ub4M
- Source
- EnVhog (cluster: phalp2_14968)
- Protein name
- 4RzbJ
- Lysin probability
- 95%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MMHHRFIIGLVALGLAITLTPNAPIHLEIKPKEVVPKVVEIPDLSLDQLPVSWQKLAMCESSGRLNAVSGKRKQFQGAFQIEYPRTWVAHGGSSGKQPKDSTLLEQFYVALHIYVDRGSKPWPYCGKFLKEDYGK
- Physico‐chemical
properties -
protein length: 135 AA molecular weight: 15173,5 Da isoelectric point: 9,27 hydropathy: -0,21
Representative Protein Details
- Accession
- ub4M
- Protein name
- ub4M
- Sequence length
- 125 AA
- Molecular weight
- 14056,21480 Da
- Isoelectric point
- 9,27618
- Sequence
-
VALGLAITLTPNAPIHLEIKPKEVVPKVVEIPDLSLDQLPVSWQKLAMCESSGRLNAVSGKRKQFQGLFQIEYPRTWVAHGGSKTKPPKDSTLLEQFWVALHIYVDRGSKPWPYCGKFLKEDYGK
Other Proteins in cluster: phalp2_14968
| Total (incl. this protein): 61 | Avg length: 135,9 | Avg pI: 8,81 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| ub4M | 125 | 9,27618 |
| 12LRQ | 134 | 9,55165 |
| 15aKe | 167 | 7,84279 |
| 17Ltr | 134 | 9,09792 |
| 1PeNc | 137 | 8,56838 |
| 1QKwS | 125 | 8,89233 |
| 1ZPTs | 141 | 8,53776 |
| 1iEQ6 | 137 | 6,96234 |
| 1qePt | 137 | 8,60229 |
| 1tMvb | 134 | 8,88724 |
| 1yeME | 134 | 8,86777 |
| 27WDW | 136 | 8,95139 |
| 2cZ4A | 133 | 9,19804 |
| 2j68f | 134 | 9,10115 |
| 30P3a | 134 | 8,95145 |
| 31rsY | 189 | 6,57732 |
| 33S94 | 136 | 9,12094 |
| 38gph | 138 | 9,65016 |
| 3VZdD | 133 | 9,42001 |
| 3Xw0H | 138 | 9,09818 |
| 3YGq2 | 137 | 8,97505 |
| 49TxJ | 134 | 9,30061 |
| 49cg3 | 133 | 9,26206 |
| 4ILxU | 149 | 9,51310 |
| 4JbsX | 138 | 9,48022 |
| 4OvOn | 133 | 9,26206 |
| 4YeSk | 136 | 8,53653 |
| 4aMc6 | 125 | 8,89233 |
| 4alPf | 134 | 9,27463 |
| 4b5jN | 136 | 8,56748 |
| 4bVNL | 134 | 9,27463 |
| 4ba2h | 134 | 8,86777 |
| 5CeIE | 128 | 8,62234 |
| 5CsVA | 136 | 8,90574 |
| 5kEul | 148 | 9,69097 |
| 5zib4 | 134 | 9,12081 |
| 6Gmwe | 139 | 9,51703 |
| 6Ishi | 138 | 9,44915 |
| 6KyUU | 117 | 9,12081 |
| 6L8vV | 136 | 9,09818 |
| 820Pq | 133 | 9,61296 |
| 83cSx | 138 | 9,44960 |
| 88QCp | 133 | 9,61296 |
| 8mwEH | 135 | 9,30029 |
| 8mzjz | 186 | 6,28829 |
| Cfd6 | 135 | 8,88692 |
| FiuY | 136 | 8,58237 |
| GTT2 | 136 | 8,86829 |
| GeoX | 134 | 9,09818 |
| H2In | 137 | 6,96342 |
| H81o | 122 | 7,01708 |
| IUqT | 133 | 8,53260 |
| J36l | 96 | 6,95564 |
| KYBD | 120 | 7,74110 |
| SFJS | 134 | 9,32750 |
| TEEJ | 139 | 7,94658 |
| UlDh | 135 | 8,86777 |
| c8ql | 133 | 8,53260 |
| t08s | 133 | 9,19804 |
| uewW | 133 | 9,19804 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_5644
4nxT7
|
113 | 39,0% | 82 | 1.415E-12 |
| 2 |
phalp2_9852
3lxBI
|
49 | 36,3% | 77 | 1.546E-07 |
| 3 |
phalp2_25711
4F4dB
|
1 | 27,6% | 105 | 6.833E-04 |
| 4 |
phalp2_7086
6IbtN
|
30 | 28,5% | 84 | 9.305E-04 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(ub4M)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50