Protein
- Protein accession
- 4QiG1 [EnVhog]
- Representative
- 3OKnd
- Source
- EnVhog (cluster: phalp2_20469)
- Protein name
- 4QiG1
- Lysin probability
- 95%
- PhaLP type
-
VAL
Probability: 61% (predicted by ML model) - Protein sequence
-
VTIADEILAAARSCLGTPFRHQGRLPGVALDCAGLICHVCESIGVPYTDEQGYSRLPHHGRLQAALDAQESLARVSDPAPGDVLLFRFKTEPMHLGIYAGETLIHAYEQSGKVCEHRIDDAWRARIVQAYKIVRPDHG
- Physico‐chemical
properties -
protein length: 138 AA molecular weight: 15154,1 Da isoelectric point: 6,23 hydropathy: -0,15
Representative Protein Details
- Accession
- 3OKnd
- Protein name
- 3OKnd
- Sequence length
- 165 AA
- Molecular weight
- 18104,32130 Da
- Isoelectric point
- 6,82894
- Sequence
-
MKKLTAQLTPQLTAQQVISAARQYVGLKYRTQGRDVVGESAGLDCGGLLVVVCKELSITDSDLSGYSNSPDGATFEKLLQTDLDEVTPKEDVRLADILAMNYGEGVQHIAIVSAINKEANRYTVIHAKRPRGSFGSTDKGVIEQYLHGYDLRAWSKTFRIKGIEN
Other Proteins in cluster: phalp2_20469
| Total (incl. this protein): 174 | Avg length: 138,8 | Avg pI: 7,33 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 3OKnd | 165 | 6,82894 |
| 11al1 | 141 | 6,50979 |
| 14CK6 | 135 | 6,88681 |
| 14CeL | 135 | 5,90213 |
| 14G1g | 137 | 6,49797 |
| 16ZMq | 136 | 6,95319 |
| 16ZyV | 139 | 7,01691 |
| 1907S | 137 | 6,38958 |
| 1AEn0 | 136 | 8,80182 |
| 1BNhf | 138 | 9,27773 |
| 1CpYP | 140 | 9,77549 |
| 1Fvkq | 155 | 5,72831 |
| 1KUCp | 136 | 6,75528 |
| 1L4k3 | 137 | 5,78362 |
| 1La5G | 138 | 7,06573 |
| 1Lh5N | 140 | 6,58937 |
| 1LkPg | 141 | 6,96229 |
| 1M9sL | 137 | 6,99412 |
| 1MfEH | 138 | 7,05789 |
| 1R0U3 | 138 | 6,35167 |
| 1SGSl | 141 | 8,37124 |
| 1XHUm | 136 | 7,17003 |
| 1XNGG | 138 | 6,17376 |
| 1Xh0p | 136 | 6,64314 |
| 1XiWE | 137 | 5,08944 |
| 1Xk7h | 137 | 5,73269 |
| 1XnO5 | 137 | 5,14048 |
| 1XqaP | 135 | 8,79080 |
| 1YdHt | 138 | 6,26953 |
| 1Z6L9 | 136 | 6,18058 |
| 1a0iW | 142 | 7,84749 |
| 1gmEr | 164 | 8,39967 |
| 1jYSk | 154 | 9,12571 |
| 1jmhY | 129 | 5,92407 |
| 1l7Mg | 135 | 6,58368 |
| 1ozLc | 137 | 5,68892 |
| 20C3W | 138 | 6,27664 |
| 25dcm | 149 | 6,18706 |
| 29mLL | 134 | 9,27534 |
| 2HAlh | 137 | 5,58093 |
| 2LnWm | 141 | 7,78831 |
| 2Px1l | 140 | 7,70114 |
| 2Q480 | 138 | 5,90235 |
| 2QXh3 | 133 | 9,07252 |
| 2S5YP | 140 | 7,01287 |
| 2cJJ8 | 141 | 8,53924 |
| 2ckWS | 142 | 9,66550 |
| 35cn9 | 140 | 7,65493 |
| 36BAu | 137 | 6,56970 |
| 36CVx | 138 | 8,62788 |
| 36x8o | 137 | 6,49183 |
| 36zMV | 137 | 7,01310 |
| 39YDR | 137 | 8,49018 |
| 3Qqgo | 164 | 7,07551 |
| 3R9On | 137 | 6,16251 |
| 3TWMc | 144 | 6,58562 |
| 3VpUQ | 133 | 9,32575 |
| 3ZpLm | 143 | 7,75843 |
| 3bGkF | 139 | 8,29355 |
| 3eoT3 | 139 | 8,88885 |
| 3g7GJ | 137 | 7,01555 |
| 3mD09 | 139 | 8,38168 |
| 3nnav | 135 | 6,05355 |
| 3zAuQ | 140 | 5,17453 |
| 40VE2 | 133 | 7,87747 |
| 452gp | 143 | 7,09972 |
| 46Jw4 | 128 | 6,39316 |
| 47Sho | 133 | 9,02997 |
| 47UDF | 135 | 5,77782 |
| 49Tp4 | 128 | 7,99783 |
| 4FOyn | 150 | 8,71021 |
| 4GM0S | 152 | 7,02362 |
| 4IQuQ | 138 | 7,00998 |
| 4LHPm | 136 | 7,97147 |
| 4LIC7 | 137 | 8,66263 |
| 4LQlS | 136 | 6,58755 |
| 4MDL9 | 133 | 8,73922 |
| 4Mo4D | 136 | 9,22950 |
| 4Nb3W | 136 | 6,99662 |
| 4QjU7 | 123 | 6,39032 |
| 4Qn2U | 135 | 6,69475 |
| 4QrN3 | 136 | 6,13846 |
| 4YxyR | 138 | 7,17725 |
| 4ZUBI | 142 | 7,12570 |
| 4dEdR | 144 | 6,28966 |
| 4eN5Y | 137 | 5,37352 |
| 4f5rk | 138 | 6,49092 |
| 4fXCw | 146 | 6,12556 |
| 4fdW1 | 136 | 6,64160 |
| 4fo26 | 137 | 7,80682 |
| 4gzps | 137 | 5,80868 |
| 4kV8D | 139 | 8,40934 |
| 4m3s9 | 111 | 5,70427 |
| 4qSLv | 158 | 6,74380 |
| 4sL3g | 140 | 6,51121 |
| 4tsHr | 140 | 6,95825 |
| 4ubof | 144 | 6,69634 |
| 4wzzM | 137 | 6,05258 |
| 4xs7z | 136 | 7,79347 |
| 51hgi | 111 | 5,92100 |
| 51yQg | 111 | 5,91395 |
| 51zZD | 111 | 6,12471 |
| 5Bu2c | 145 | 6,49973 |
| 5I8B4 | 140 | 8,70589 |
| 5IGzf | 160 | 5,85603 |
| 5JovA | 141 | 6,98946 |
| 5f4WT | 111 | 6,12965 |
| 5fdiE | 111 | 6,37736 |
| 5liKX | 158 | 5,71592 |
| 5sKSv | 135 | 8,68030 |
| 5xaNZ | 143 | 7,89842 |
| 6E1kt | 135 | 9,35154 |
| 6MiCb | 177 | 9,01727 |
| 6PEiu | 137 | 9,12165 |
| 6Qtdl | 136 | 6,96070 |
| 6RkzJ | 138 | 7,01299 |
| 6SMQe | 149 | 6,28238 |
| 6SSJo | 136 | 6,96331 |
| 6Sqh9 | 138 | 8,76121 |
| 6VgIy | 133 | 6,58158 |
| 6W5LO | 138 | 6,70390 |
| 6WWki | 167 | 10,55465 |
| 6XBPb | 137 | 6,49155 |
| 721Sm | 141 | 9,03043 |
| 75O37 | 138 | 6,33621 |
| 7Cs0O | 136 | 8,50920 |
| 7L07v | 138 | 8,57386 |
| 7V8oM | 137 | 9,01121 |
| 7XXmD | 137 | 9,44167 |
| 7deRb | 140 | 8,52557 |
| 7eiKO | 139 | 7,77710 |
| 7f9fG | 143 | 6,11925 |
| 7gBrh | 139 | 6,14415 |
| 808be | 138 | 4,99935 |
| 80zci | 137 | 6,27721 |
| 81plG | 137 | 9,32363 |
| 85PBX | 145 | 9,23743 |
| 867Dz | 142 | 5,75162 |
| 8A3lJ | 145 | 9,35792 |
| 8COfr | 145 | 9,31834 |
| 8CPPz | 145 | 8,69326 |
| 8CngT | 145 | 9,23743 |
| 8CozZ | 145 | 9,21906 |
| 8FneN | 128 | 9,46565 |
| 8a75o | 137 | 6,06918 |
| 8aD7u | 139 | 4,95621 |
| 8eITB | 137 | 8,85817 |
| 8eJEr | 138 | 5,91105 |
| 8fLe9 | 138 | 7,03385 |
| 8ix2i | 137 | 6,89476 |
| 8n3po | 134 | 9,36579 |
| 8pPqT | 137 | 8,46594 |
| 8rePD | 137 | 6,17376 |
| 8yOCe | 141 | 9,12287 |
| 95xu | 141 | 6,74107 |
| 991J | 139 | 6,73925 |
| AOae | 135 | 7,72433 |
| ASNF | 133 | 9,09605 |
| ZXTX | 149 | 7,65743 |
| Zw4S | 138 | 6,49092 |
| cZDq | 137 | 8,98543 |
| dgeQ | 148 | 8,52912 |
| e73p | 152 | 8,69119 |
| e9lS | 136 | 8,49456 |
| hBzP | 140 | 8,00389 |
| i9hf | 137 | 9,05164 |
| jaWn | 139 | 4,99628 |
| jkhE | 140 | 5,77680 |
| l9iE | 137 | 7,77185 |
| mbtJ | 133 | 7,83570 |
| qEdt | 138 | 6,49035 |
| rFB | 137 | 7,76804 |
| w7Hp | 145 | 9,13261 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_38771
1fCGD
|
1216 | 33,9% | 153 | 8.237E-59 |
| 2 |
phalp2_28766
4PrSU
|
248 | 28,6% | 150 | 2.510E-40 |
| 3 |
phalp2_36512
1oWEW
|
304 | 26,5% | 128 | 8.183E-36 |
| 4 |
phalp2_922
7oz39
|
3811 | 24,6% | 158 | 1.259E-33 |
| 5 |
phalp2_19724
4MrB2
|
69 | 28,1% | 160 | 1.139E-32 |
| 6 |
phalp2_29511
1Z7BX
|
61 | 25,9% | 162 | 4.008E-32 |
| 7 |
phalp2_33260
5BBWg
|
36 | 27,5% | 160 | 2.390E-30 |
| 8 |
phalp2_201
5IaYc
|
48 | 32,2% | 118 | 4.508E-27 |
| 9 |
phalp2_18529
6TZ8D
|
34 | 21,2% | 146 | 4.508E-27 |
| 10 |
phalp2_14018
8dxHF
|
12 | 23,8% | 151 | 6.171E-27 |
Domains
Domains
1
165 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(3OKnd)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50