Protein
- Protein accession
- 4QZ6o [EnVhog]
- Representative
- tIut
- Source
- EnVhog (cluster: phalp2_39798)
- Protein name
- 4QZ6o
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MPMKITTRDIWGAKPNKKPFSKLGEVKGLVVHWSAYPTAVGNMAEMDQCKTIQRLHQEDRGWNDVAYNFLVGDTGQIYEGRGFGNRSAAQGGNNREEINYNNKHYVAVCWLGGSNPTDKPSDKAIASVKWLSEQVGGELRPHSSFKQTQCPGDAWRQWIIEEKAPDISNKAPDKVYIPDSFESKLDKILDILEDIQRKLKLGKLIQ
- Physico‐chemical
properties -
protein length: 206 AA molecular weight: 23245,1 Da isoelectric point: 8,65 hydropathy: -0,70
Representative Protein Details
- Accession
- tIut
- Protein name
- tIut
- Sequence length
- 149 AA
- Molecular weight
- 16675,48740 Da
- Isoelectric point
- 7,15952
- Sequence
-
EDRGWNDVAYNFLVGDTGQIYEGRGFGNRSAAQGGNSRQEINYNNKHYVAVCWLGGSKPTDKPSDKAVESVKWLYEQVGGELRPHSSFKQTSCPGDAWRQHIVEGLAVSTVSNESPPEMIHPQFIQKKLDTIIAKLENIENKLKLGRMI
Other Proteins in cluster: phalp2_39798
| Total (incl. this protein): 152 | Avg length: 181,7 | Avg pI: 8,52 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| tIut | 149 | 7,15952 |
| 13Ltk | 210 | 9,06453 |
| 13T7P | 134 | 8,85649 |
| 17eFw | 186 | 6,88050 |
| 1AWDx | 93 | 8,72807 |
| 1AdJS | 205 | 8,95371 |
| 1AeMZ | 205 | 8,89820 |
| 1BMLo | 204 | 8,87183 |
| 1BSbv | 108 | 8,55774 |
| 1BVWh | 166 | 8,43429 |
| 1BXPO | 116 | 7,97482 |
| 1Bb1n | 111 | 8,01853 |
| 1BhF7 | 118 | 7,97411 |
| 1BjsI | 233 | 9,24904 |
| 1Blm2 | 204 | 8,79331 |
| 1BqGE | 218 | 9,38532 |
| 1BvGM | 191 | 9,03797 |
| 1C7l7 | 110 | 8,55774 |
| 1CaQP | 173 | 8,43216 |
| 1CbJ5 | 91 | 8,78777 |
| 1EP2J | 205 | 9,13016 |
| 1ERbA | 106 | 8,57302 |
| 1ESzi | 206 | 8,89820 |
| 1FacH | 137 | 8,57264 |
| 1FcP8 | 147 | 7,94323 |
| 1HRaq | 220 | 9,18405 |
| 1ec0D | 217 | 9,00741 |
| 1eul | 204 | 8,85933 |
| 1n4ZV | 113 | 7,92802 |
| 1n507 | 115 | 8,93572 |
| 1n5WP | 133 | 9,36785 |
| 1qKgh | 210 | 9,37791 |
| 228Rq | 200 | 9,06717 |
| 24ef8 | 204 | 9,02075 |
| 26Cxr | 144 | 8,87428 |
| 26LLq | 218 | 8,74290 |
| 26gkx | 232 | 9,18489 |
| 26i3K | 226 | 8,31715 |
| 26nbi | 204 | 8,65818 |
| 27CsT | 203 | 9,09734 |
| 27cyl | 127 | 7,73979 |
| 27ilf | 223 | 9,08187 |
| 27wEM | 198 | 8,45498 |
| 28dKF | 207 | 6,96274 |
| 28eSM | 234 | 9,02056 |
| 28fat | 221 | 9,09728 |
| 29tzd | 204 | 9,04938 |
| 2Halo | 173 | 6,30733 |
| 2JLC2 | 233 | 9,13770 |
| 2JO0Q | 121 | 8,55749 |
| 2K6Be | 205 | 8,79183 |
| 2KjgV | 204 | 8,87183 |
| 2KxTU | 152 | 7,02254 |
| 2Ky9A | 138 | 7,08813 |
| 2M8nP | 181 | 7,05692 |
| 2MOCq | 101 | 8,58269 |
| 2MVab | 179 | 5,84193 |
| 2Mm5h | 223 | 8,98459 |
| 2MmAg | 101 | 8,58269 |
| 2MwhU | 116 | 8,58991 |
| 2N73j | 220 | 9,09689 |
| 2OARo | 218 | 8,96886 |
| 2OGED | 233 | 9,06975 |
| 2OfWo | 218 | 8,97215 |
| 2ReBt | 175 | 7,20851 |
| 2RrOM | 178 | 7,93195 |
| 2TAs2 | 216 | 9,23698 |
| 2Tl5R | 234 | 9,26483 |
| 2a2RR | 204 | 8,40173 |
| 2a57C | 177 | 6,48791 |
| 2fh3n | 201 | 8,87099 |
| 2gUf5 | 143 | 8,52441 |
| 2gV2G | 218 | 9,21958 |
| 2gWL0 | 186 | 6,42317 |
| 2gWwO | 201 | 9,03700 |
| 2gf8X | 180 | 9,05234 |
| 2h3N3 | 198 | 9,09747 |
| 2h5Kz | 228 | 9,11043 |
| 2hhmS | 205 | 8,89897 |
| 2hjQw | 205 | 9,15304 |
| 2hsIu | 205 | 9,28243 |
| 2hury | 218 | 9,40131 |
| 2i833 | 223 | 8,92624 |
| 2iOJf | 165 | 8,49115 |
| 2iaCd | 175 | 7,86561 |
| 2ihih | 184 | 7,20817 |
| 2kSAY | 149 | 6,36480 |
| 2vsyN | 204 | 8,87183 |
| 3VmQI | 221 | 9,17032 |
| 3Ycxf | 209 | 9,41195 |
| 3Z3ji | 205 | 9,30003 |
| 3Z7Sq | 142 | 8,54279 |
| 3ZaiW | 228 | 9,25980 |
| 3Zini | 216 | 9,30010 |
| 3Zo7D | 220 | 8,95777 |
| 3guUV | 204 | 8,82451 |
| 3hJJq | 204 | 8,66934 |
| 42Ghd | 205 | 9,18463 |
| 42YLA | 220 | 9,28172 |
| 439hx | 222 | 9,54933 |
| 43g0f | 112 | 8,93598 |
| 43lpu | 108 | 7,94349 |
| 4WpR7 | 99 | 8,58269 |
| 4jn1F | 207 | 8,92695 |
| 4jnzI | 205 | 9,26580 |
| 4sHen | 234 | 9,26490 |
| 4sIEx | 139 | 7,95967 |
| 4siTp | 142 | 8,60487 |
| 4txkK | 99 | 6,99281 |
| 5Aa4l | 124 | 7,01924 |
| 5AblM | 84 | 8,07965 |
| 5Afo7 | 112 | 6,90624 |
| 5qQ24 | 206 | 6,90556 |
| 5qQ3t | 131 | 6,34570 |
| 5sXY7 | 163 | 7,87586 |
| 6BrUi | 204 | 9,00715 |
| 6FPc | 123 | 8,93521 |
| 6G1t | 138 | 8,85701 |
| 6JnUg | 204 | 8,92882 |
| 7SRNB | 209 | 9,22538 |
| 81njZ | 218 | 9,09715 |
| 828p8 | 234 | 9,08310 |
| 82Ded | 234 | 9,16761 |
| 82lzw | 221 | 9,30016 |
| 85Ahc | 234 | 9,08310 |
| 8dtae | 206 | 7,68914 |
| 8fy3Z | 223 | 9,28224 |
| 8gCBZ | 209 | 9,40170 |
| 8tg3w | 206 | 8,33468 |
| A7oU | 197 | 8,90368 |
| ADCI | 163 | 7,19698 |
| An6U | 88 | 8,44473 |
| ApDM | 113 | 7,96689 |
| AqEN | 113 | 7,92537 |
| C8W | 132 | 8,55845 |
| CFK | 150 | 7,08665 |
| RcmJ | 223 | 6,52872 |
| Re7P | 166 | 9,45733 |
| gI7G | 148 | 8,51655 |
| gJth | 233 | 8,92644 |
| iiE7 | 234 | 9,16987 |
| pC4I | 234 | 9,18354 |
| pE7k | 218 | 8,96886 |
| qrxw | 179 | 6,48518 |
| qtSv | 223 | 9,12403 |
| sIeD | 116 | 8,58985 |
| szsK | 198 | 9,11327 |
| tP8b | 218 | 9,13151 |
| u0MP | 151 | 6,36218 |
| uzjy | 211 | 9,26851 |
| vphO | 204 | 8,84746 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_12028
4UJTX
|
1 | 38,2% | 94 | 1.465E-19 |
| 2 |
phalp2_39895
1eEek
|
97 | 30,7% | 166 | 4.546E-15 |
| 3 |
phalp2_19971
6P1vg
|
1 | 34,6% | 98 | 1.258E-12 |
| 4 |
phalp2_3469
4c4b1
|
1 | 32,8% | 143 | 3.872E-11 |
| 5 |
phalp2_23799
1eilo
|
4 | 31,0% | 129 | 3.872E-11 |
| 6 |
phalp2_20575
4zFeO
|
1 | 32,6% | 104 | 3.412E-10 |
| 7 |
phalp2_8096
6x5t2
|
1 | 32,6% | 104 | 4.911E-06 |
| 8 |
phalp2_11894
2jrH4
|
329 | 22,9% | 109 | 1.418E-04 |
Domains
Domains
1
149 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(tIut)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50