Protein
- Protein accession
- 4LUTG [EnVhog]
- Representative
- d8Lo
- Source
- EnVhog (cluster: phalp2_26149)
- Protein name
- 4LUTG
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MKFECKIFKFQHNFDLKFLNFSKNHQKSSNLIKSLDFSLKWAYLRHINHEKESNSMSINSNLLVPEFRTKLETLINECKNRGFIMVPYFGIRTPFEQGKLWRQSRTSQEIKAKIAILKEQGADFLAFCIESVGPCNGPLVTKAIPGLSWHQFGEACDCMWSVNGRAEWSTKKLVNGINGYIEYAKIASSQSLDAGGLWPAKDWPHVQLRKASSPLKIMSLSEIDKIMKERFGDK
- Physico‐chemical
properties -
protein length: 234 AA molecular weight: 26854,8 Da isoelectric point: 9,39 hydropathy: -0,38
Representative Protein Details
- Accession
- d8Lo
- Protein name
- d8Lo
- Sequence length
- 181 AA
- Molecular weight
- 20207,16850 Da
- Isoelectric point
- 8,56541
- Sequence
-
MSKDLNDLAPTLHGICIEHLHISALEGIDMRILQTWRPLEKQARLYRSTRSIEEIRAKAKALAHLGCQHCADVLISVGPQLYPPWLQPGKHLTMAGPGESKHHKLDIFHGIWACAYDIGCFDKDGKYIQDGKHPDYVTAGRIGTGLGLQWLGEGTQKFKEAAHFQLKGLPGTKERIKLVVE
Other Proteins in cluster: phalp2_26149
| Total (incl. this protein): 162 | Avg length: 169,9 | Avg pI: 7,55 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| d8Lo | 181 | 8,56541 |
| 107bJ | 173 | 5,02044 |
| 107xC | 176 | 6,83332 |
| 16y4w | 190 | 6,04712 |
| 17Y03 | 141 | 8,90761 |
| 17jDm | 183 | 6,15841 |
| 18BIw | 139 | 8,93404 |
| 19y56 | 176 | 10,19634 |
| 1E9BO | 166 | 6,96360 |
| 1FQTw | 186 | 9,22699 |
| 1HQbc | 168 | 9,84821 |
| 1HSEP | 188 | 8,83734 |
| 1I9Vs | 170 | 5,34164 |
| 1Jaff | 165 | 6,17979 |
| 1Jbyv | 171 | 8,83218 |
| 1KH2j | 169 | 5,30117 |
| 1Kl7i | 141 | 9,48067 |
| 1LEcI | 182 | 8,24037 |
| 1MUk4 | 176 | 6,05860 |
| 1QYMH | 173 | 8,15159 |
| 1RiCz | 168 | 9,38597 |
| 1VnA6 | 175 | 8,70924 |
| 1Z0aH | 179 | 7,66681 |
| 1azyU | 139 | 8,58314 |
| 1ibBH | 170 | 9,25929 |
| 1jlKd | 183 | 7,01151 |
| 1laEg | 177 | 9,11037 |
| 1lgoX | 182 | 8,55168 |
| 1lic1 | 165 | 5,90258 |
| 1lrBO | 173 | 5,27531 |
| 1rddx | 139 | 7,09592 |
| 1soXh | 139 | 7,81088 |
| 1xyXj | 181 | 6,59323 |
| 20LWo | 175 | 8,41707 |
| 23tL | 170 | 5,23052 |
| 2JHgx | 170 | 5,89565 |
| 2V80c | 172 | 5,83506 |
| 2aqtO | 139 | 8,92818 |
| 2ctif | 177 | 7,69273 |
| 2cvE2 | 164 | 9,46817 |
| 2k1Bl | 182 | 9,61270 |
| 2k1fz | 174 | 5,73093 |
| 2kYqj | 181 | 4,63138 |
| 2l2bg | 176 | 9,20849 |
| 2l2tT | 177 | 6,53992 |
| 2ntat | 188 | 6,07424 |
| 2sjkv | 172 | 6,40930 |
| 2tAwY | 163 | 8,89691 |
| 2yvei | 185 | 6,47455 |
| 2zBzi | 188 | 9,71179 |
| 30dvM | 139 | 8,95152 |
| 31avs | 139 | 7,12530 |
| 35j56 | 170 | 4,98611 |
| 36kDL | 167 | 6,47569 |
| 39GR9 | 192 | 5,82767 |
| 39wda | 131 | 6,35968 |
| 3CIRM | 164 | 5,36585 |
| 3LHLh | 174 | 7,83247 |
| 3S1om | 172 | 9,00032 |
| 3Vi6g | 170 | 5,12258 |
| 3XAV | 187 | 5,20596 |
| 3Xo1E | 175 | 7,01475 |
| 3Xzsj | 173 | 6,30148 |
| 3YjAd | 174 | 4,79110 |
| 3dh58 | 160 | 7,67903 |
| 3erqg | 180 | 9,32608 |
| 3f332 | 133 | 4,94473 |
| 3f469 | 158 | 8,90561 |
| 451dm | 143 | 8,94217 |
| 45OQC | 190 | 6,53696 |
| 45P1W | 169 | 5,35477 |
| 45PB4 | 172 | 9,74370 |
| 45Q3Z | 171 | 7,71421 |
| 46n6w | 139 | 9,22867 |
| 47R37 | 174 | 5,40416 |
| 47SnM | 175 | 6,89726 |
| 47TMa | 172 | 9,29848 |
| 47U1n | 190 | 7,67448 |
| 4BpE | 171 | 8,37794 |
| 4Buup | 210 | 8,22850 |
| 4CKU2 | 161 | 5,06517 |
| 4CM2d | 166 | 5,91821 |
| 4Dt8H | 175 | 6,43471 |
| 4EIgl | 160 | 7,19368 |
| 4EPTd | 134 | 4,96320 |
| 4FIks | 141 | 9,32369 |
| 4Gbrh | 139 | 9,35728 |
| 4GiBg | 139 | 9,26122 |
| 4H62M | 179 | 8,88299 |
| 4HVdW | 181 | 5,96783 |
| 4HsWI | 213 | 8,60332 |
| 4JV73 | 192 | 6,30159 |
| 4KJ24 | 166 | 4,80678 |
| 4NdpD | 157 | 9,50859 |
| 4NpCh | 139 | 9,55107 |
| 4Npc8 | 139 | 9,39009 |
| 4OVxk | 158 | 8,83186 |
| 4UY7H | 177 | 9,15298 |
| 4XGo8 | 181 | 7,11513 |
| 4XpMx | 182 | 6,58942 |
| 4Y8lc | 181 | 7,74399 |
| 4aImv | 142 | 9,55127 |
| 4cax2 | 171 | 5,62333 |
| 4ctH8 | 139 | 9,42555 |
| 4gLbP | 172 | 6,10391 |
| 4irsk | 173 | 9,12932 |
| 4jzRf | 171 | 8,93772 |
| 4qizt | 196 | 7,79702 |
| 4yXRf | 160 | 8,42687 |
| 4yYyH | 154 | 6,12573 |
| 4zL2t | 170 | 8,65954 |
| 4zciU | 143 | 9,01102 |
| 53D7X | 141 | 9,44812 |
| 5CSDw | 201 | 9,13229 |
| 5DQL0 | 186 | 6,72220 |
| 5GDz | 177 | 7,78773 |
| 5HjQN | 139 | 9,26122 |
| 5JE0m | 168 | 9,00122 |
| 5T7fI | 177 | 7,64379 |
| 5cpSq | 196 | 9,16117 |
| 5dHKL | 175 | 7,68363 |
| 6ALwK | 172 | 6,52218 |
| 6LuSc | 180 | 9,04364 |
| 6NUBF | 181 | 7,82699 |
| 6NVvB | 178 | 5,07904 |
| 6U0QF | 143 | 9,00032 |
| 6VPzE | 167 | 9,40337 |
| 6yeHT | 141 | 9,47990 |
| 6yi8J | 141 | 9,47990 |
| 7UQ5E | 179 | 5,97318 |
| 7W1HT | 190 | 7,77423 |
| 7e2K8 | 176 | 8,70505 |
| 7eNm | 168 | 9,79392 |
| 7lpM | 187 | 5,31242 |
| 7lw7I | 176 | 6,90363 |
| 7mlJJ | 180 | 6,05633 |
| 7oeJh | 181 | 6,52508 |
| 80245 | 172 | 9,07858 |
| 85LDB | 213 | 7,72836 |
| 87mis | 141 | 8,92863 |
| 89GSi | 186 | 6,37662 |
| 8Bg9W | 158 | 5,59218 |
| 8BggJ | 180 | 7,95864 |
| 8CKmD | 134 | 6,73027 |
| 8D73K | 170 | 8,68765 |
| 8eW0w | 190 | 8,79234 |
| 8l8PL | 177 | 5,42667 |
| 8pKMl | 173 | 6,20065 |
| 8pQxE | 177 | 8,75985 |
| 8w8i9 | 175 | 8,70924 |
| A5Fx | 175 | 6,04633 |
| IivR | 170 | 4,69487 |
| UDhD | 180 | 7,80056 |
| UJG4 | 181 | 8,36292 |
| ULLa | 174 | 7,01248 |
| VRtJ | 181 | 7,14423 |
| f5lW | 183 | 5,84779 |
| h1cw | 134 | 5,48345 |
| i8Px | 185 | 6,19843 |
| ig86 | 176 | 8,69338 |
| jjtZ | 186 | 6,16001 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_1337
15l6q
|
1516 | 29,3% | 167 | 3.497E-43 |
| 2 |
phalp2_32329
8CRp5
|
10 | 22,1% | 221 | 8.234E-39 |
| 3 |
phalp2_35414
f7cN
|
32 | 24,2% | 169 | 8.291E-30 |
| 4 |
phalp2_27726
6US3d
|
23 | 23,2% | 172 | 2.339E-27 |
| 5 |
phalp2_39989
1NC6w
|
21 | 23,6% | 165 | 2.564E-25 |
| 6 |
phalp2_33559
8Bkl8
|
2 | 26,6% | 150 | 1.675E-24 |
| 7 |
phalp2_15634
2Dd0a
|
83 | 22,6% | 168 | 1.495E-23 |
| 8 |
phalp2_23122
4DyQf
|
2 | 29,8% | 124 | 2.488E-22 |
| 9 |
phalp2_33807
1hNOs
|
60 | 18,5% | 167 | 2.488E-22 |
| 10 |
phalp2_627
1bpyM
|
18 | 25,4% | 169 | 2.488E-22 |
Domains
Domains
1
181 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(d8Lo)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50