Protein
- Protein accession
- 4K1cb [EnVhog]
- Representative
- 3zUSo
- Source
- EnVhog (cluster: phalp2_17227)
- Protein name
- 4K1cb
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MIQLTSEILLEIAPQASRELIVDLTPHLNRYLPEYGIDTLLRLDHFLGQSAEETAGFRTLVEYASGREYEGRKDLGNVEAGDGPRFKGRGIFQLTGRLNYMAMTHTLGVDLVSNPDLAATPEIAVRTACEYWKSRDLSKYADADDLETITRRINGGTNGIADRETFTTRADKALTPLFGE
- Physico‐chemical
properties -
protein length: 180 AA molecular weight: 20025,3 Da isoelectric point: 4,97 hydropathy: -0,37
Representative Protein Details
- Accession
- 3zUSo
- Protein name
- 3zUSo
- Sequence length
- 225 AA
- Molecular weight
- 24896,73640 Da
- Isoelectric point
- 5,02914
- Sequence
-
MTIEEFFQKMVGIPTPNTAVNTTPTTLESITRVDTTPIPAPVANVVHVAPPITTSGLKLTPQLIEDIITPYVSNANKANIEALVPYLNEYLPQYGINDLLRVSHFLGQAAEESADFMTLKEYASGSEYEDRRDLGNIYPGDGPRYKGRGIFQLTGRANYESVGKALGLDLVNHPELAETPEVAVRTACEYWKSRNLQVYADRDDIRSMTLHINGGYNGLTTRTTF
Other Proteins in cluster: phalp2_17227
| Total (incl. this protein): 139 | Avg length: 191,8 | Avg pI: 8,18 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 3zUSo | 225 | 5,02914 |
| 10nyF | 179 | 5,61151 |
| 11dDT | 177 | 8,88750 |
| 11dt0 | 143 | 7,77516 |
| 17jy9 | 177 | 8,90471 |
| 1J9P9 | 225 | 9,12126 |
| 1KNO4 | 176 | 9,00038 |
| 1LgJ5 | 172 | 9,14673 |
| 1cLQh | 176 | 9,48286 |
| 1dc5r | 210 | 9,19482 |
| 1gLKB | 200 | 9,24259 |
| 1kXhk | 173 | 8,88782 |
| 1kkAv | 197 | 9,44650 |
| 1opiJ | 182 | 8,49779 |
| 1pddR | 194 | 8,57940 |
| 1pxfO | 184 | 5,69535 |
| 1qsU2 | 228 | 9,23737 |
| 1zHiP | 222 | 9,25729 |
| 23anW | 184 | 9,37533 |
| 2EVLW | 198 | 8,88853 |
| 2QOKE | 173 | 9,49724 |
| 2T4Iy | 186 | 7,67476 |
| 2btGn | 180 | 5,80397 |
| 2iL2t | 224 | 9,15324 |
| 37RAC | 178 | 9,08129 |
| 3OLre | 199 | 8,91561 |
| 3OQSY | 182 | 7,71177 |
| 3THzv | 184 | 9,48125 |
| 3UZRD | 181 | 4,95275 |
| 3ZteB | 184 | 9,50833 |
| 3iTQP | 237 | 5,62561 |
| 3nxg | 173 | 9,43052 |
| 3xQUD | 171 | 9,07459 |
| 3z0Un | 179 | 4,79706 |
| 3zX6h | 179 | 4,79706 |
| 3zmBn | 179 | 4,63774 |
| 45GNf | 185 | 8,98459 |
| 47N7J | 242 | 6,93239 |
| 47huC | 177 | 4,82611 |
| 48R8b | 237 | 5,79584 |
| 496aS | 186 | 9,19488 |
| 4Ip5v | 173 | 4,96883 |
| 4J0Fi | 228 | 5,62890 |
| 4JFpS | 181 | 4,86027 |
| 4MDJu | 177 | 4,88948 |
| 4OxcZ | 172 | 6,83377 |
| 4SBRX | 172 | 9,41782 |
| 4SE6d | 172 | 8,81323 |
| 4Vm2c | 248 | 9,84808 |
| 4a9JE | 217 | 9,51961 |
| 4aBFQ | 225 | 8,92173 |
| 4beIK | 186 | 9,29713 |
| 4eWPk | 197 | 6,01092 |
| 4gFiu | 185 | 9,51968 |
| 4grHD | 177 | 8,92560 |
| 4khfX | 186 | 9,71740 |
| 4lipd | 211 | 9,39480 |
| 4nZm3 | 179 | 9,87483 |
| 4nvq9 | 192 | 9,20520 |
| 59PEZ | 199 | 9,71863 |
| 5BATg | 191 | 5,05284 |
| 5BInE | 186 | 9,38655 |
| 5HB42 | 194 | 9,02772 |
| 5He8K | 195 | 6,13426 |
| 5aHZw | 186 | 9,19488 |
| 5hCVN | 186 | 9,38655 |
| 5nI0a | 186 | 7,67636 |
| 5rBe9 | 216 | 9,88566 |
| 5wsQD | 244 | 6,33695 |
| 5y5F3 | 191 | 8,58031 |
| 5y5IE | 186 | 9,38655 |
| 5yf9u | 199 | 7,08790 |
| 6CEdy | 178 | 5,67443 |
| 6D5RQ | 178 | 5,67443 |
| 6E50M | 178 | 5,31282 |
| 6Fdcw | 180 | 5,36267 |
| 6FnC0 | 180 | 5,35829 |
| 6IYgg | 180 | 5,14509 |
| 6MmvA | 199 | 9,66770 |
| 6Nt3d | 179 | 4,88266 |
| 6OcXZ | 176 | 5,35886 |
| 6S5aL | 201 | 8,40618 |
| 6VBhQ | 185 | 8,74728 |
| 6W7ZZ | 180 | 9,71173 |
| 6XNtC | 251 | 5,90235 |
| 6rUMH | 186 | 9,74976 |
| 72zX7 | 180 | 9,48525 |
| 79LCF | 183 | 9,51665 |
| 79LDt | 172 | 9,23711 |
| 7HOtr | 180 | 9,20262 |
| 7ViI5 | 225 | 9,36495 |
| 7Vqr0 | 138 | 9,77555 |
| 7WQOm | 186 | 9,29468 |
| 7aQLp | 181 | 8,64800 |
| 7beyj | 196 | 9,33111 |
| 7dAIT | 192 | 9,62669 |
| 7dTTc | 194 | 9,27760 |
| 7e12k | 222 | 9,28585 |
| 7hvDm | 176 | 7,83441 |
| 7q28E | 186 | 9,68426 |
| 7qP3T | 193 | 7,09876 |
| 7seB6 | 236 | 8,97530 |
| 7seBi | 239 | 9,62540 |
| 7ser1 | 273 | 7,87025 |
| 7sezC | 235 | 9,17019 |
| 7tlRn | 185 | 9,71785 |
| 7vKzm | 200 | 9,11411 |
| 7vM2H | 170 | 9,47010 |
| 7w9oz | 195 | 8,78538 |
| 7wmAv | 182 | 9,47887 |
| 7wmoR | 177 | 9,35483 |
| 7wmt9 | 185 | 9,71108 |
| 7wmwP | 184 | 9,71108 |
| 7xEbv | 188 | 8,89304 |
| 7xEdf | 187 | 8,26203 |
| 7yhvw | 180 | 4,76205 |
| 7zIJy | 178 | 9,40589 |
| 83W8c | 217 | 9,09631 |
| 84PA | 141 | 9,21487 |
| 87VZV | 194 | 9,02772 |
| 87ga2 | 199 | 9,51968 |
| 8bkff | 197 | 8,46246 |
| 8f1Zh | 186 | 9,29468 |
| 8iSpq | 191 | 5,98579 |
| 8ivTe | 173 | 9,26541 |
| 8ivTo | 242 | 5,88695 |
| 8k40t | 185 | 9,78967 |
| 8kP0z | 185 | 9,75943 |
| 8njCe | 194 | 6,97036 |
| 8nmlt | 223 | 9,11469 |
| 8ocON | 189 | 9,88792 |
| 8puM4 | 177 | 9,05267 |
| 8rZCw | 186 | 9,46507 |
| 8somq | 175 | 9,68098 |
| SnnA | 188 | 8,61615 |
| mHM5 | 176 | 4,72329 |
| pLGd | 172 | 9,29816 |
| z0Sh | 189 | 8,19685 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_1654
8rD3A
|
4011 | 50,3% | 163 | 3.559E-72 |
| 2 |
phalp2_23269
4XEAI
|
9 | 49,4% | 168 | 2.640E-69 |
| 3 |
phalp2_16916
27hsI
|
40 | 49,6% | 165 | 1.042E-66 |
| 4 |
phalp2_22262
7pbAz
|
301 | 49,3% | 156 | 6.883E-66 |
| 5 |
phalp2_32955
3ZpUq
|
39 | 48,7% | 160 | 2.451E-62 |
| 6 |
phalp2_14498
4ODLg
|
45 | 35,7% | 176 | 6.297E-62 |
| 7 |
phalp2_6233
6x5Zy
|
12 | 43,3% | 166 | 1.076E-57 |
| 8 |
phalp2_13918
dfym
|
14 | 53,1% | 160 | 1.820E-56 |
| 9 |
phalp2_4732
4TAVg
|
3 | 35,6% | 171 | 5.200E-54 |
| 10 |
phalp2_82
4Uvd5
|
73 | 31,5% | 209 | 1.334E-53 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(3zUSo)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50