Protein
- Protein accession
- 4GlaP [EnVhog]
- Representative
- 84qjx
- Source
- EnVhog (cluster: phalp2_21422)
- Protein name
- 4GlaP
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MLEISKFGQDVRQWQLFLVGQGLAPGVVDGSFGPKTRDATIEFQKKHGLDNDGVVGPKTLQEAAKLGYGKANVLQSGGFVKALTYMDKQRLFGPLTYVAASSSDNPETIKITNSWAKKLKKVEIPQLAGVIGAPKDCTVLFHEKGADKLVQLWKKWEDNDLLHFVLSWSGAWAPRFVRGSKTYLSSHAFATAFDINAQWNPLGVPPPASGAHGSVRDLVPAASELGFFWGGNFPKRPDGMHFELGEQ
- Physico‐chemical
properties -
protein length: 247 AA molecular weight: 26995,5 Da isoelectric point: 9,04 hydropathy: -0,26
Representative Protein Details
- Accession
- 84qjx
- Protein name
- 84qjx
- Sequence length
- 262 AA
- Molecular weight
- 29697,44370 Da
- Isoelectric point
- 7,79966
- Sequence
-
MRVLRFGMQGDDVFLWQNFLIGLDPYSELVATGVFDKPTEDETKAFQRKVDNSGKNVDGVVGPKTYAHAMLLGFSNLEDSDDSEYSENWPQRPEGISPLSPVDRMKLFGSFTFRSAPVKSNPEAIVITDSWDKANIVLAKVPQLKKVSYSENVSCHKLIADQLRSLFNEWEKNDMTKLIITYGGMWVPRFIRGSRTSLSNHSWGTAFDINMQWNGLGVTPALKGKYGSVRELVDIAYKHGFYWGGHFKKRPDGMHFEAFKVL
Other Proteins in cluster: phalp2_21422
| Total (incl. this protein): 127 | Avg length: 257,8 | Avg pI: 8,16 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 84qjx | 262 | 7,79966 |
| 13mY | 269 | 7,19504 |
| 15ggh | 320 | 9,01766 |
| 161fV | 261 | 7,02811 |
| 17GFt | 261 | 9,12365 |
| 18jiU | 262 | 8,56309 |
| 19PXX | 262 | 7,95612 |
| 1BIZ5 | 275 | 9,64345 |
| 1DYkG | 283 | 9,44386 |
| 1FUGR | 172 | 9,76923 |
| 1HnYE | 184 | 9,83957 |
| 1IBYV | 193 | 10,21967 |
| 1JGud | 233 | 8,88511 |
| 1PaSW | 261 | 9,29952 |
| 1Pc4v | 261 | 9,27102 |
| 1QTdO | 261 | 8,87177 |
| 1QaPd | 261 | 9,47094 |
| 1QkDg | 261 | 9,15227 |
| 1XVb8 | 261 | 9,06382 |
| 1ZD3I | 212 | 9,51581 |
| 1cOAC | 273 | 9,04274 |
| 1iwKt | 262 | 9,04506 |
| 1lCsN | 269 | 6,60386 |
| 1ppZB | 222 | 6,03900 |
| 1wTLj | 261 | 8,75244 |
| 1zC4r | 317 | 9,39474 |
| 1zDfI | 206 | 9,46385 |
| 2G9Jn | 249 | 9,41479 |
| 2bcua | 265 | 5,53910 |
| 2cIDv | 260 | 9,40408 |
| 2cXzx | 262 | 8,62647 |
| 2ceWd | 257 | 7,02185 |
| 2d1e2 | 262 | 8,62750 |
| 2d4Zb | 262 | 6,97729 |
| 2g6O5 | 220 | 9,96702 |
| 2jMrW | 257 | 9,99655 |
| 2jfXD | 252 | 6,50763 |
| 2mEU7 | 268 | 5,46845 |
| 2oSIy | 184 | 9,43490 |
| 2yE8C | 203 | 5,22267 |
| 37V9K | 285 | 9,36753 |
| 3OYcc | 253 | 9,51819 |
| 3QmNb | 273 | 9,83486 |
| 3Qy97 | 242 | 6,43056 |
| 3U2Mc | 258 | 7,13172 |
| 3j6jP | 264 | 7,19919 |
| 42d7G | 279 | 6,97968 |
| 42hbj | 261 | 9,07897 |
| 4A9WL | 260 | 6,59670 |
| 4BNay | 201 | 8,05450 |
| 4BTOe | 265 | 7,13150 |
| 4C1XI | 262 | 7,89378 |
| 4CT8g | 286 | 9,19688 |
| 4CVU8 | 269 | 6,44124 |
| 4Dmhz | 263 | 8,00415 |
| 4F9ZL | 259 | 6,39043 |
| 4GbIz | 258 | 9,05305 |
| 4GjrQ | 263 | 6,30250 |
| 4HgXB | 261 | 6,76665 |
| 4Kmvq | 266 | 9,82719 |
| 4LDNv | 259 | 5,71473 |
| 4Mq9Z | 245 | 6,91761 |
| 4NGkE | 263 | 8,66541 |
| 4NRLd | 261 | 9,16381 |
| 4Pzbx | 246 | 9,16768 |
| 4Rj0u | 259 | 7,89552 |
| 4Rkl2 | 264 | 5,26928 |
| 4bsEO | 274 | 8,62814 |
| 4cbf9 | 266 | 6,07605 |
| 4ce5m | 257 | 7,79231 |
| 4crl6 | 266 | 6,43346 |
| 4fYQY | 263 | 6,21486 |
| 4fZzJ | 259 | 6,29693 |
| 4gUYn | 244 | 9,96103 |
| 4lPGO | 320 | 9,16890 |
| 4lgyq | 191 | 9,96696 |
| 4lpW6 | 318 | 9,23582 |
| 4mLRL | 230 | 9,36508 |
| 4zPI9 | 260 | 8,78003 |
| 55P0r | 328 | 9,31318 |
| 5DnZR | 256 | 7,01890 |
| 5H4se | 266 | 6,59158 |
| 5HfI5 | 233 | 9,13158 |
| 5cgsa | 258 | 9,72765 |
| 5kzPC | 229 | 9,44090 |
| 5mtUL | 229 | 8,78635 |
| 5sI2U | 263 | 9,18315 |
| 5uMnD | 251 | 7,86174 |
| 5wAW4 | 328 | 9,38339 |
| 5xtos | 323 | 8,70267 |
| 5zFGq | 268 | 4,92995 |
| 5zuiW | 262 | 6,86276 |
| 6Cico | 195 | 7,21721 |
| 6EWtu | 176 | 9,22976 |
| 6MHlj | 262 | 6,86276 |
| 6NcjT | 230 | 7,73246 |
| 6VMfz | 272 | 8,58695 |
| 6wUYU | 177 | 6,36599 |
| 6wWR3 | 267 | 6,52434 |
| 7Fjax | 247 | 5,26746 |
| 7JOTR | 265 | 9,12223 |
| 7Kfnj | 274 | 8,93598 |
| 7cwu7 | 287 | 8,71324 |
| 7pomx | 293 | 9,16626 |
| 80LWW | 262 | 8,70905 |
| 82Vtg | 253 | 7,90107 |
| 85SSI | 267 | 6,90937 |
| 85T0s | 261 | 6,91540 |
| 87THQ | 262 | 8,62750 |
| 8m00k | 288 | 8,78873 |
| 8rmJ0 | 262 | 9,91629 |
| EsSC | 324 | 6,08958 |
| EvPb | 262 | 9,06221 |
| IkcY | 247 | 8,59533 |
| PQCc | 311 | 8,08706 |
| RE31 | 264 | 9,84331 |
| RY00 | 262 | 8,73110 |
| XXWh | 280 | 9,53309 |
| YYYg | 282 | 9,24665 |
| YcXI | 257 | 10,25926 |
| avDz | 262 | 6,97746 |
| eLPs | 263 | 7,02953 |
| jLN6 | 261 | 9,37004 |
| jjzl | 256 | 5,38330 |
| k0u6 | 261 | 7,97708 |
| saGc | 206 | 5,11650 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_35054
4UUzg
|
1 | 53,1% | 177 | 8.031E-74 |
| 2 |
phalp2_663
1llnD
|
1 | 43,6% | 172 | 1.466E-55 |
| 3 |
phalp2_32878
3eE2c
|
24 | 29,8% | 258 | 4.748E-46 |
| 4 |
phalp2_2616
6M0Mp
|
4 | 25,8% | 259 | 1.365E-31 |
| 5 |
phalp2_23014
3S8Y1
|
5 | 34,7% | 167 | 1.445E-27 |
| 6 |
phalp2_7463
4QPri
|
21 | 29,1% | 247 | 2.676E-27 |
| 7 |
phalp2_19861
5zIVL
|
30 | 28,9% | 173 | 6.741E-23 |
| 8 |
phalp2_13964
hgZ4
|
6 | 23,8% | 264 | 3.018E-20 |
| 9 |
phalp2_35627
1l2XB
|
20 | 24,0% | 229 | 1.871E-19 |
| 10 |
phalp2_31287
8j7Mq
|
27 | 30,7% | 169 | 4.761E-13 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(84qjx)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50