Protein

Protein accession
48hVY [EnVhog]
Representative
8mZo1
Source
EnVhog (cluster: phalp2_31263)
Protein name
48hVY
Lysin probability
82%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MQMSPPAIEVLVKQFEGLKLEAYRCPANVCTIGYGHTSQAGPPLVFDGMKITKQQADDILSSDLHKFEAAVDELVKVRLTQNQFDTLVDFAYNAGIGALKSSTLLKRVNAGDFAAVPVELMKWTKGKIPGKGLQVLPGLVRRRQVEIAWWNK
Physico‐chemical
properties
protein length:152 AA
molecular weight:16783,4 Da
isoelectric point:9,12
hydropathy:-0,09
Representative Protein Details
Accession
8mZo1
Protein name
8mZo1
Sequence length
143 AA
Molecular weight
15919,93780 Da
Isoelectric point
9,30048
Sequence
MKISENGLKLIKSFEGCRLTAYKDSVGIWTIGYGTTNADKAITGATICQGLQISQETADEWLRQSVDKKYGPKVEKYNAAYGWNQNEFDALVSFAYNIGSIDQLTANGTRSRSMIAEKILQYNKAGGKMKMVNGHSTYQMVRK
Other Proteins in cluster: phalp2_31263
Total (incl. this protein): 167 Avg length: 149,0 Avg pI: 8,97

Protein ID Length (AA) pI
8mZo1 143 9,30048
12YFM 156 7,70637
12ZeQ 156 7,69619
15uvx 157 9,35960
16EhF 156 6,58459
1FSbY 144 9,53908
1IhUp 199 4,77228
1LQOL 147 9,08097
1Laf7 149 9,55758
1LbkM 178 9,43632
1LrE9 149 9,55758
1Mnab 149 9,47423
1Msmy 149 9,55758
1Mx9q 147 9,08097
1gybP 190 9,15343
1m7Sf 144 9,53844
1neVF 144 9,35844
1r6fm 146 10,24875
20wZ7 150 9,46565
24SJg 156 5,48595
25hyC 148 8,60687
2Bdu8 150 9,42259
2BpWV 150 9,26116
2CAYF 147 8,97853
2CDlt 150 9,50614
2CmLx 150 9,25903
2UkOE 156 9,99507
2Y98e 193 4,83776
2YlRE 149 9,40241
2ZQAP 155 9,68336
2cvRV 151 6,61835
2dhqd 122 9,45398
2lQ0d 144 9,70902
30nfY 182 7,69125
31S1C 149 9,51619
366jU 151 5,07040
36Sg2 145 9,19495
3704g 149 9,42272
3NOee 151 6,05133
3bn3S 157 6,82127
3bpZG 157 6,82042
3c0uR 206 10,61287
3cH4V 157 9,84872
3fXZR 164 4,83804
3gGtd 120 4,79820
3jKGz 144 9,53876
3jKds 144 9,37991
3kP8Y 126 9,37862
3kX99 112 6,27732
3m8yI 144 9,35850
3mcM8 144 9,35876
3oUjR 144 9,53876
3oYpT 125 9,38068
3p9ve 144 9,46572
3pfz1 144 9,56268
3tyFE 144 9,46572
3w03E 144 9,70941
3wvqm 144 9,37991
49uKi 149 9,51619
4Gb14 150 9,56293
4GdOy 155 9,55726
4HYM9 168 7,78161
4Wqdo 151 8,55787
4YqWb 150 9,68336
4aaI8 149 9,56293
4qMps 150 9,53876
4tSYy 150 9,68762
4ybOU 158 9,83299
4yqqk 164 6,85043
4yriL 164 6,85043
53LHg 149 9,47423
56qz3 121 7,91628
57O9o 150 9,46533
5KE15 144 9,62663
5KXMj 144 9,53876
5KXWc 144 9,53876
5LVKh 139 10,13490
5MPn6 144 9,46572
5MaUq 144 9,53876
5MdFP 137 9,32414
5Nlhh 144 9,53876
5OKLh 119 5,43434
5OVn9 144 9,53876
5QeKP 144 9,25722
5RHzm 144 9,62663
5S3vs 144 9,53876
5Vl9n 144 9,53876
5YGiX 154 8,94094
5f0Le 150 9,49466
5g1TZ 155 9,57886
5giAf 149 9,47423
5hTtu 142 9,81223
5hW2s 142 9,81223
5hYPm 142 9,85098
5hZcx 193 5,62657
5i0nN 142 9,65951
5iEqj 178 9,41840
5inYX 142 9,53960
5kzO0 151 6,51252
5lMjZ 149 9,55758
60Uip 144 9,46572
60dTi 165 9,98494
616LO 144 9,58846
63WH9 139 10,09931
64QXB 144 9,56268
688pN 144 9,62656
6APPD 150 9,56293
6WGZG 153 5,10883
6a7Ru 144 9,46597
6aCW3 170 9,56016
6atdU 144 9,46572
6bVCM 91 8,57889
6cZH4 144 9,62656
6dOiK 216 8,27047
6fZTT 144 9,48912
6geWw 144 9,62663
6hatA 144 9,44335
6ijeO 152 9,49331
6jUsg 144 9,37991
6kPzj 139 10,13490
6kxcf 165 10,00802
6nMxY 144 9,46572
6nMz0 144 9,53876
6nlth 144 9,56268
6oPmW 144 9,58846
6oz3d 144 9,46533
6qxgd 144 9,44386
6rmXM 144 9,70941
6s2WQ 91 7,71341
6sxIz 137 9,16091
6tdCs 144 9,46572
6twze 144 9,53876
6u6sO 144 9,53844
6udhs 144 9,56268
6wNtQ 144 9,53876
6woy3 144 9,46572
71tUQ 144 9,67994
7BHcl 141 10,34648
7OiGE 144 9,56268
7xAkT 144 9,67298
7yZ3T 145 9,14324
7yZ4z 145 8,88556
7zxII 144 9,53876
7zy9A 144 9,53811
86LCi 139 5,54018
8Dg4j 150 9,56300
8b0ax 144 9,25722
8fAvX 142 9,81958
8fItF 223 9,85936
8fKxE 140 10,22676
8m3s5 144 9,46533
8nQrZ 139 10,07049
8tBKl 147 8,94185
9yRG 169 6,41254
H8vv 152 5,27372
LkGX 149 9,56293
Odyc 156 10,17461
OrDO 144 9,56300
TKdc 153 8,77468
YR9a 150 9,58949
goon 144 9,65242
mdZ0 117 6,25629
o6E1 132 9,75060
q9Op 147 9,46572
z5N8 144 9,62624
A0A8S5U878 223 9,88063
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_33221
5jbqV
447 45,1% 135 6.255E-43
2 phalp2_4451
31DIk
4919 40,4% 136 3.139E-39
3 phalp2_9745
82S7v
113 42,1% 133 3.139E-39
4 phalp2_126
5jCCA
637 39,2% 135 5.901E-39
5 phalp2_2632
6RhYr
14867 41,3% 133 1.109E-38
6 phalp2_31530
48EM7
20 49,4% 99 2.858E-38
7 phalp2_2176
3Yhf4
930 40,4% 141 1.010E-37
8 phalp2_33124
4MhZ3
118 46,2% 132 2.602E-37
9 phalp2_34878
4dXDH
390 39,8% 128 1.784E-33
10 phalp2_31105
1YRHZ
456 40,4% 131 1.184E-32

Domains

Domains
Representative sequence (used for alignment): 8mZo1 (143 AA)
Member sequence: 48hVY (152 AA)
1 143 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8mZo1) rather than this protein.
PDB ID
8mZo1
Method AlphaFoldv2
Resolution 90.15
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50