Protein
- Protein accession
- 46wwH [EnVhog]
- Representative
- 1aKpM
- Source
- EnVhog (cluster: phalp2_35584)
- Protein name
- 46wwH
- Lysin probability
- 75%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MRSVIRLFAVSLVGIITFGSMVKAAEAPANPANPSVTPLSEAYRAFDKVLILPVEVVPEGVPADRTKRCPQFEDEFAEFGLPVQTFSYIAWRESKCNPMAWNKTLNRNGSQDRGLVQINSSWVTVTARECASQKGDLSVLFDVRCNLAVARYLYRNGGLRHWNL
- Physico‐chemical
properties -
protein length: 164 AA molecular weight: 18292,8 Da isoelectric point: 9,02 hydropathy: -0,09
Representative Protein Details
- Accession
- 1aKpM
- Protein name
- 1aKpM
- Sequence length
- 142 AA
- Molecular weight
- 16005,38600 Da
- Isoelectric point
- 9,64861
- Sequence
-
LKKFFVVLFALLVLNPTVANAKSEVPPKWLVERVENGDRCKKLEPAIAAAGLPVTFFTYMAWRESRCRVGAVNARFNKQGKVVWTLNRNGTFDSGVFQINSSWRTKTREVCGGGLDRLLKWDCNLAMAVELYSDGGLHHWGF
Other Proteins in cluster: phalp2_35584
| Total (incl. this protein): 156 | Avg length: 149,4 | Avg pI: 9,33 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1aKpM | 142 | 9,64861 |
| 154Sl | 129 | 9,91925 |
| 15gBd | 107 | 9,58982 |
| 162ll | 164 | 9,23324 |
| 17Hqn | 164 | 5,73246 |
| 18GyI | 163 | 9,76117 |
| 18nfz | 135 | 8,74786 |
| 18v2s | 164 | 8,94430 |
| 19F6I | 135 | 9,83061 |
| 19UsN | 170 | 9,04390 |
| 1ELD1 | 174 | 8,32701 |
| 1I1ai | 130 | 9,85394 |
| 1JMbm | 126 | 9,43503 |
| 1JqRm | 128 | 10,30986 |
| 1Kc5z | 175 | 9,13873 |
| 1KdBP | 164 | 9,29687 |
| 1MkZR | 164 | 9,35264 |
| 1OAnI | 164 | 9,88579 |
| 1PdED | 161 | 9,70928 |
| 1aAYs | 142 | 9,85485 |
| 1iBAK | 188 | 9,64623 |
| 1iL6t | 174 | 8,60874 |
| 1jxtG | 82 | 10,29845 |
| 1sN7E | 114 | 9,00032 |
| 1tLNZ | 128 | 10,25758 |
| 1wV7U | 164 | 8,77900 |
| 1xNZg | 173 | 8,28137 |
| 1ya3B | 175 | 9,02424 |
| 1ycTu | 128 | 10,22328 |
| 20xtw | 164 | 9,07626 |
| 2696p | 127 | 4,74989 |
| 28gEk | 127 | 5,59912 |
| 2JP3L | 127 | 5,21898 |
| 2Qi4C | 148 | 9,48506 |
| 2ZWVN | 123 | 9,78206 |
| 2hAxY | 173 | 9,39802 |
| 2iGac | 134 | 9,41640 |
| 2jjtN | 181 | 8,40837 |
| 33w9d | 180 | 6,03752 |
| 362P3 | 81 | 10,10241 |
| 36HsD | 169 | 9,56461 |
| 37tjJ | 128 | 10,25758 |
| 3VX0V | 171 | 9,47558 |
| 44yO4 | 176 | 9,81140 |
| 45TBR | 128 | 10,54872 |
| 46RwF | 164 | 9,97850 |
| 46ud5 | 164 | 8,88073 |
| 47Jpm | 173 | 9,09554 |
| 48ODa | 128 | 10,69435 |
| 49Tt6 | 164 | 8,77900 |
| 4AeNi | 164 | 9,69019 |
| 4GEJ6 | 128 | 10,48606 |
| 4NQxO | 145 | 9,56506 |
| 4V91e | 153 | 9,62315 |
| 4aG2X | 169 | 8,38890 |
| 4b0PD | 169 | 8,67778 |
| 4bcZi | 164 | 9,41833 |
| 4bvte | 132 | 9,76917 |
| 4fHre | 158 | 9,79960 |
| 4mRUK | 133 | 9,32608 |
| 4mUH7 | 129 | 9,69342 |
| 4mk5I | 165 | 9,52696 |
| 4nx32 | 142 | 9,91712 |
| 4oYY2 | 164 | 9,02114 |
| 4opnI | 153 | 9,65667 |
| 4p6UA | 164 | 9,97656 |
| 4qkBW | 128 | 10,35428 |
| 4s2Ag | 164 | 8,39812 |
| 4x0eg | 144 | 10,10408 |
| 4zXxD | 164 | 9,77768 |
| 503Ly | 152 | 9,72965 |
| 50LR7 | 102 | 10,13509 |
| 50aK8 | 164 | 9,02114 |
| 52wz7 | 124 | 9,60787 |
| 5677d | 164 | 10,11137 |
| 56Lc2 | 128 | 10,22322 |
| 56M2Q | 145 | 9,18405 |
| 57UNF | 159 | 10,01724 |
| 58UKf | 164 | 9,02114 |
| 58vQs | 148 | 9,18025 |
| 5AAiV | 148 | 9,83576 |
| 5AVsm | 164 | 9,23337 |
| 5AtBW | 164 | 9,20578 |
| 5C4r4 | 113 | 10,30310 |
| 5bOMv | 128 | 10,54872 |
| 5bhj9 | 147 | 9,38893 |
| 5c4Ug | 144 | 10,15256 |
| 5cMqO | 155 | 9,75705 |
| 5cY8A | 137 | 9,28391 |
| 5fRWO | 148 | 9,76975 |
| 5g4kF | 164 | 8,77951 |
| 5gi2M | 144 | 10,18731 |
| 5gvCL | 128 | 10,70512 |
| 5hAfi | 154 | 9,08110 |
| 5hMxC | 164 | 9,04390 |
| 5i7tb | 128 | 10,30703 |
| 5iO78 | 128 | 10,54872 |
| 5leTU | 179 | 9,41214 |
| 5tlXj | 128 | 10,22322 |
| 5v2Rm | 148 | 9,56867 |
| 5vdvg | 142 | 9,83525 |
| 5vtxW | 164 | 9,23311 |
| 5w0kf | 144 | 10,18731 |
| 5wVOI | 164 | 8,73200 |
| 5wpMb | 164 | 9,02114 |
| 5wwpy | 164 | 9,26341 |
| 5xsFp | 164 | 8,76295 |
| 5yRDp | 121 | 9,79998 |
| 5yylm | 128 | 10,22328 |
| 5ziO3 | 128 | 10,15263 |
| 6A16c | 117 | 6,75357 |
| 6Ap1u | 128 | 10,54202 |
| 6GLPo | 161 | 9,88134 |
| 6GeGB | 113 | 8,96241 |
| 6Is7A | 129 | 9,92815 |
| 6KwWN | 111 | 9,63482 |
| 6xN5W | 128 | 10,10292 |
| 6yPwz | 175 | 8,99342 |
| 6yb17 | 148 | 9,73004 |
| 6zDQ2 | 161 | 9,02121 |
| 6zenI | 128 | 10,54202 |
| 7XUex | 179 | 5,40206 |
| 7Xhcg | 128 | 10,40882 |
| 80Oiv | 176 | 9,27431 |
| 81UT5 | 176 | 8,91232 |
| 81r53 | 128 | 10,41295 |
| 82J3g | 130 | 4,98361 |
| 84uMk | 142 | 9,84788 |
| 8B1NQ | 135 | 8,38742 |
| 8mtVU | 164 | 9,04345 |
| 8nWDS | 149 | 9,79083 |
| 8ogWd | 157 | 9,66763 |
| 8rts7 | 129 | 9,72591 |
| 8xlVe | 190 | 9,63404 |
| AGM9 | 130 | 9,23137 |
| Chl0 | 174 | 8,34790 |
| Hiyv | 164 | 9,32453 |
| IIkQ | 179 | 8,88801 |
| Pi0k | 164 | 9,20565 |
| RRQz | 138 | 9,32653 |
| T1LN | 176 | 9,09947 |
| Ub45 | 128 | 10,25758 |
| UfEl | 135 | 8,38748 |
| X9e0 | 164 | 9,85285 |
| aziD | 153 | 9,69342 |
| bTf2 | 164 | 10,16539 |
| hOdk | 174 | 8,32901 |
| hXtA | 132 | 10,18905 |
| sTDH | 175 | 9,12822 |
| suH0 | 180 | 9,41214 |
| t488 | 152 | 9,65764 |
| tB7d | 164 | 9,04319 |
| zZcx | 135 | 9,27650 |
| zeZq | 178 | 8,32901 |
| A0A6J7XPR1 | 171 | 9,15678 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_5595
4aSfH
|
29 | 48,3% | 118 | 5.649E-56 |
| 2 |
phalp2_23920
1O60H
|
47 | 40,7% | 152 | 1.724E-50 |
| 3 |
phalp2_39980
1L23W
|
13 | 38,3% | 99 | 9.885E-25 |
| 4 |
phalp2_8459
165nm
|
626 | 28,2% | 124 | 5.428E-19 |
| 5 |
phalp2_26521
7XVtu
|
369 | 28,8% | 125 | 3.912E-13 |
| 6 |
phalp2_39934
1p4NQ
|
5 | 27,0% | 148 | 2.554E-12 |
| 7 |
phalp2_10602
5BOvL
|
251 | 28,0% | 107 | 4.772E-12 |
| 8 |
phalp2_9463
ADPc
|
1205 | 26,3% | 129 | 6.522E-12 |
| 9 |
phalp2_8391
CgjB
|
207 | 26,4% | 106 | 8.913E-12 |
| 10 |
phalp2_9230
6SW0S
|
30 | 24,2% | 128 | 7.922E-11 |
Domains
Domains
1
142 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1aKpM)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50