Protein

Protein accession
46PrL [EnVhog]
Representative
2cPfi
Source
EnVhog (cluster: phalp2_24155)
Protein name
46PrL
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MSTLLHPVSPAKITDLFGTHSEQRKAMGLGPHRGVDYAVPVGTPLKAVGTGTIVKVYESKVLGHVVELRCWVGGEDDRRLRVFAYCHLDKAEVKVGKKVRQGEVIAHSGNSGTSSGPHLHLMCGPSEHLATMPVED
Physico‐chemical
properties
protein length:136 AA
molecular weight:14630,7 Da
isoelectric point:8,49
hydropathy:-0,19
Representative Protein Details
Accession
2cPfi
Protein name
2cPfi
Sequence length
143 AA
Molecular weight
15327,34620 Da
Isoelectric point
9,09921
Sequence
MSQLPFPKTKITCKFGVKDAAHPNGHRGTDFGMPAGTEIPSATEGIVALSQWSDVLGWVVVVQRKPKSFWGYCHMEQKGLAVGSKVHAGKTFIGKVGDTGSASHGDHLHFTHGDTVNSVFYGKVDDPVKAIAKLVAEEKLKNA
Other Proteins in cluster: phalp2_24155
Total (incl. this protein): 141 Avg length: 162,9 Avg pI: 9,34

Protein ID Length (AA) pI
2cPfi 143 9,09921
12HTh 171 9,36211
16UJO 153 5,37097
16neE 196 9,30074
19NTc 146 9,55178
1I258 182 9,41949
1ITrp 159 9,61947
1JFrE 161 9,35174
1JQwh 189 9,95516
1JRmY 167 9,77336
1JSBS 181 9,38887
1JWO5 186 9,47023
1Jqa5 161 9,64855
1Jsr3 150 9,35161
1KHzh 155 9,08258
1KaS1 180 9,35825
1KfJ1 168 9,56345
1Kluh 163 9,73732
1Klvs 193 9,39113
1KmeZ 161 9,45927
1LCgU 162 9,61012
1LPWf 180 9,44141
1Lj3M 119 9,94800
1LkH9 168 9,63649
1LqqY 158 10,00125
1LquV 167 9,53553
1Lw5y 171 9,59046
1M4K0 180 9,35844
1cHUE 145 9,62702
1dVYB 181 9,41749
1dYAS 182 9,33858
1fFoU 170 9,44109
1pFVR 180 9,64281
1xWBW 145 9,21848
24Qgp 181 9,32447
25MhP 161 9,30087
25NNt 182 9,66408
25Ns1 139 9,85046
2869h 142 9,01592
2YsXU 146 9,21848
2cOIh 145 8,85107
2cPe7 149 9,71572
2cPiZ 148 9,57976
2cS83 148 9,05666
2cXNY 180 9,68646
30dGN 145 9,03133
30hfs 182 9,79676
316BF 174 9,37217
378DM 146 9,33523
37gY4 146 9,19546
38eY5 141 9,80082
3b2oA 157 9,49034
3b6E0 174 9,03165
3blIK 145 9,03133
3bnFM 182 9,79676
3bq2G 182 9,78084
463I3 175 9,63765
4661D 146 9,21848
46Yp8 142 9,14595
472xP 169 9,68027
47ANI 145 9,62695
47CKL 145 9,62695
47KCX 159 9,49492
47cFJ 174 9,37217
47saB 183 9,19405
491lb 147 8,76501
4936H 154 9,57596
49fB4 177 9,76021
4IVQe 157 9,35244
4ZaXl 189 9,59704
4abjY 145 9,21848
4aiXC 145 9,24317
4au94 179 9,13377
4bEuQ 153 8,90897
4badc 182 9,75550
4bxCE 147 9,41375
4gdvO 151 9,20649
4gfmp 150 9,65068
4ltdt 141 9,49460
4m4fj 168 9,56345
4mdhi 168 9,56345
4rjul 177 9,57596
4rl17 182 9,79676
50HFa 161 9,45927
532AT 173 9,79386
5EGub 163 9,66982
5EI42 176 9,27811
5cXVl 168 9,49505
5jR3q 145 9,54907
5kLpo 189 8,84978
5kTIx 147 9,54340
5kWY4 150 7,81971
5kXw4 144 9,71572
5ks0r 163 9,96825
5l4jk 120 8,84514
5l5bL 128 9,98855
5l8T8 143 9,27695
5l9ZF 189 9,89314
5la25 169 9,33800
5me5A 144 9,80024
5zFqp 184 9,40744
5zGN9 153 9,43922
5zK54 193 9,32814
6BOfz 190 9,38081
6BRGb 181 9,31924
6BSvb 149 9,39557
6BTIn 190 9,25781
6BTvr 156 9,49492
6BXnM 175 9,45869
6GAdz 153 9,17413
6GmuU 232 8,93649
6Gz7a 169 9,08194
6Gzhi 184 9,16684
6KVtC 168 9,46610
6KWdB 160 9,77671
6KafD 177 9,62785
6LvWr 150 8,52299
6Mjwm 153 9,41653
6Mn2f 142 8,88808
6Mqr7 183 9,40370
6OYVo 147 9,54043
6QiON 149 9,69767
6QiYP 176 9,30042
6Qiwa 149 9,17438
6WQI0 181 9,51800
7XeJl 144 9,12068
7XfDs 143 7,80810
7Xg3m 143 7,80301
85DWb 155 9,59291
87cOL 176 8,99329
88eFk 183 9,08174
8mGuP 168 9,59362
8mRdM 181 8,89981
8mwTo 145 9,18741
8np8G 181 9,40389
9Txd 133 7,21192
H2ed 180 9,66408
Iu7O 147 9,71850
TWn2 171 9,25613
Urks 145 9,21848
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_29414
1iBPp
693 48,3% 149 2.255E-49
2 phalp2_4831
5ksbg
93 35,4% 141 3.567E-37
3 phalp2_8002
5ma4R
98 40,0% 130 1.784E-33
4 phalp2_32059
5JbvR
2 35,6% 101 4.499E-23
5 phalp2_25623
4b5Xf
6 37,5% 96 2.171E-22
6 phalp2_10060
7ul5P
4 28,5% 133 1.047E-21
7 phalp2_40658
5cY9d
663 31,5% 133 1.434E-21
8 phalp2_5756
7Czmx
45 33,3% 108 5.081E-18
9 phalp2_3247
2k2so
54 30,8% 133 5.081E-18
10 phalp2_24104
8fsA2
7 32,4% 117 2.442E-17

Domains

Domains
Representative sequence (used for alignment): 2cPfi (143 AA)
Member sequence: 46PrL (136 AA)
1 143 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01551

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (2cPfi) rather than this protein.
PDB ID
2cPfi
Method AlphaFoldv2
Resolution 97.10
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50