Protein

Protein accession
43g0f [EnVhog]
Representative
tIut
Source
EnVhog (cluster: phalp2_39798)
Protein name
43g0f
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
QEINYNNKHYVAVCWLGGSEPTHKPSDKAIESVKWLYSQVGGELRPHSSFKQTSCPGDAWRQHIIEGLATTTVSNQSPPDMVHPNQINKKLDTIIAKLENIENKLKLGKLIR
Physico‐chemical
properties
protein length:112 AA
molecular weight:12617,2 Da
isoelectric point:8,94
hydropathy:-0,65
Representative Protein Details
Accession
tIut
Protein name
tIut
Sequence length
149 AA
Molecular weight
16675,48740 Da
Isoelectric point
7,15952
Sequence
EDRGWNDVAYNFLVGDTGQIYEGRGFGNRSAAQGGNSRQEINYNNKHYVAVCWLGGSKPTDKPSDKAVESVKWLYEQVGGELRPHSSFKQTSCPGDAWRQHIVEGLAVSTVSNESPPEMIHPQFIQKKLDTIIAKLENIENKLKLGRMI
Other Proteins in cluster: phalp2_39798
Total (incl. this protein): 152 Avg length: 181,7 Avg pI: 8,52

Protein ID Length (AA) pI
tIut 149 7,15952
13Ltk 210 9,06453
13T7P 134 8,85649
17eFw 186 6,88050
1AWDx 93 8,72807
1AdJS 205 8,95371
1AeMZ 205 8,89820
1BMLo 204 8,87183
1BSbv 108 8,55774
1BVWh 166 8,43429
1BXPO 116 7,97482
1Bb1n 111 8,01853
1BhF7 118 7,97411
1BjsI 233 9,24904
1Blm2 204 8,79331
1BqGE 218 9,38532
1BvGM 191 9,03797
1C7l7 110 8,55774
1CaQP 173 8,43216
1CbJ5 91 8,78777
1EP2J 205 9,13016
1ERbA 106 8,57302
1ESzi 206 8,89820
1FacH 137 8,57264
1FcP8 147 7,94323
1HRaq 220 9,18405
1ec0D 217 9,00741
1eul 204 8,85933
1n4ZV 113 7,92802
1n507 115 8,93572
1n5WP 133 9,36785
1qKgh 210 9,37791
228Rq 200 9,06717
24ef8 204 9,02075
26Cxr 144 8,87428
26LLq 218 8,74290
26gkx 232 9,18489
26i3K 226 8,31715
26nbi 204 8,65818
27CsT 203 9,09734
27cyl 127 7,73979
27ilf 223 9,08187
27wEM 198 8,45498
28dKF 207 6,96274
28eSM 234 9,02056
28fat 221 9,09728
29tzd 204 9,04938
2Halo 173 6,30733
2JLC2 233 9,13770
2JO0Q 121 8,55749
2K6Be 205 8,79183
2KjgV 204 8,87183
2KxTU 152 7,02254
2Ky9A 138 7,08813
2M8nP 181 7,05692
2MOCq 101 8,58269
2MVab 179 5,84193
2Mm5h 223 8,98459
2MmAg 101 8,58269
2MwhU 116 8,58991
2N73j 220 9,09689
2OARo 218 8,96886
2OGED 233 9,06975
2OfWo 218 8,97215
2ReBt 175 7,20851
2RrOM 178 7,93195
2TAs2 216 9,23698
2Tl5R 234 9,26483
2a2RR 204 8,40173
2a57C 177 6,48791
2fh3n 201 8,87099
2gUf5 143 8,52441
2gV2G 218 9,21958
2gWL0 186 6,42317
2gWwO 201 9,03700
2gf8X 180 9,05234
2h3N3 198 9,09747
2h5Kz 228 9,11043
2hhmS 205 8,89897
2hjQw 205 9,15304
2hsIu 205 9,28243
2hury 218 9,40131
2i833 223 8,92624
2iOJf 165 8,49115
2iaCd 175 7,86561
2ihih 184 7,20817
2kSAY 149 6,36480
2vsyN 204 8,87183
3VmQI 221 9,17032
3Ycxf 209 9,41195
3Z3ji 205 9,30003
3Z7Sq 142 8,54279
3ZaiW 228 9,25980
3Zini 216 9,30010
3Zo7D 220 8,95777
3guUV 204 8,82451
3hJJq 204 8,66934
42Ghd 205 9,18463
42YLA 220 9,28172
439hx 222 9,54933
43lpu 108 7,94349
4QZ6o 206 8,64735
4WpR7 99 8,58269
4jn1F 207 8,92695
4jnzI 205 9,26580
4sHen 234 9,26490
4sIEx 139 7,95967
4siTp 142 8,60487
4txkK 99 6,99281
5Aa4l 124 7,01924
5AblM 84 8,07965
5Afo7 112 6,90624
5qQ24 206 6,90556
5qQ3t 131 6,34570
5sXY7 163 7,87586
6BrUi 204 9,00715
6FPc 123 8,93521
6G1t 138 8,85701
6JnUg 204 8,92882
7SRNB 209 9,22538
81njZ 218 9,09715
828p8 234 9,08310
82Ded 234 9,16761
82lzw 221 9,30016
85Ahc 234 9,08310
8dtae 206 7,68914
8fy3Z 223 9,28224
8gCBZ 209 9,40170
8tg3w 206 8,33468
A7oU 197 8,90368
ADCI 163 7,19698
An6U 88 8,44473
ApDM 113 7,96689
AqEN 113 7,92537
C8W 132 8,55845
CFK 150 7,08665
RcmJ 223 6,52872
Re7P 166 9,45733
gI7G 148 8,51655
gJth 233 8,92644
iiE7 234 9,16987
pC4I 234 9,18354
pE7k 218 8,96886
qrxw 179 6,48518
qtSv 223 9,12403
sIeD 116 8,58985
szsK 198 9,11327
tP8b 218 9,13151
u0MP 151 6,36218
uzjy 211 9,26851
vphO 204 8,84746
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_12028
4UJTX
1 38,2% 94 1.465E-19
2 phalp2_39895
1eEek
97 30,7% 166 4.546E-15
3 phalp2_19971
6P1vg
1 34,6% 98 1.258E-12
4 phalp2_3469
4c4b1
1 32,8% 143 3.872E-11
5 phalp2_23799
1eilo
4 31,0% 129 3.872E-11
6 phalp2_20575
4zFeO
1 32,6% 104 3.412E-10
7 phalp2_8096
6x5t2
1 32,6% 104 4.911E-06
8 phalp2_11894
2jrH4
329 22,9% 109 1.418E-04

Domains

Domains
Unannotated
Representative sequence (used for alignment): tIut (149 AA)
Member sequence: 43g0f (112 AA)
1 149 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (tIut) rather than this protein.
PDB ID
tIut
Method AlphaFoldv2
Resolution 88.91
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50