Protein

Protein accession
3tunt [EnVhog]
Representative
3Pylt
Source
EnVhog (cluster: phalp2_23011)
Protein name
3tunt
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MHIIEVFTTGNKCYQVGAPLRPQGLMLHSIGTPQPSAAVLARYFDQYQPGGQSVCVHAFLEASGAVYQTLPWEMRGWHCGGAANGTHIGVEMTEPDVSMPYAESAEQITGTYRAAVELFAQLCGVYGLDPLADGVIIGHAEGHRREVASNHADPELLWNTYGMGYTMDGFRRDVAAAMAAKNTDTEDEDMTRYNTIDDVPEWARGDLQRMVREGVLQGDANGKLDLSEDMLRTMIVCQRMIDEAKET
Physico‐chemical
properties
protein length:247 AA
molecular weight:27162,3 Da
isoelectric point:4,72
hydropathy:-0,31
Representative Protein Details
Accession
3Pylt
Protein name
3Pylt
Sequence length
223 AA
Molecular weight
24697,22660 Da
Isoelectric point
9,33555
Sequence
MRISKSILTKNPCYKAGKTITVKGLMLHSIGCNQPSAMSLIESWNTSSAKVCVHGFIDANTGKVYQTLPWNRRGWHCGGSANGTHIGIEMCEPDCIKYTNGASFQCSDNARAKAMVERTYKSAVELFAHLCKEYKLNPLAEGVILAHSEGYKKGLASNHADPEHLWKGLKLPYTMDGFRKDVKAAMTPKYYKVQVGAFTNRQNAEKLLIRLEKAGFEGFISNS
Other Proteins in cluster: phalp2_23011
Total (incl. this protein): 316 Avg length: 277,4 Avg pI: 6,31

Protein ID Length (AA) pI
3Pylt 223 9,33555
10At0 252 9,18328
10Ay3 250 6,20417
10CLI 250 6,79439
136LE 279 9,25671
136ac 280 8,11659
138kj 318 9,35986
13dnL 244 8,61435
13rii 263 8,66489
14yFe 241 8,68049
1734J 195 6,69117
19kRr 291 6,31660
1FGij 276 5,94726
1FMEG 259 9,49866
1FPML 246 8,30831
1FvP7 204 7,06238
1GSgb 272 6,82673
1Gf8u 276 5,40444
1NB6K 279 7,05619
1gC1v 282 9,08825
1gFcn 247 8,73909
1gG1u 235 9,30132
1k2X7 249 4,80491
1k2nH 313 4,83162
1khn6 304 4,99185
1m1UO 327 9,56139
1nXEp 312 5,08029
1o9NH 274 5,68603
1obsc 248 5,86433
1ocBV 313 4,97571
1qU8k 295 8,73052
1zK3R 279 5,92873
24Sc2 286 7,78896
2ViyE 245 5,08740
2d9eg 189 6,62171
2lDhx 275 5,58178
2lSHh 274 9,48454
2m2fz 299 5,12696
2mA7V 300 5,06148
2ooqW 268 5,61100
3B0T6 246 4,54697
3B1bR 246 5,14100
3B5RL 300 4,74261
3GMKr 304 4,58574
3GMKw 299 4,72351
3GPSL 246 5,12639
3JrNB 308 5,22483
3KNA4 246 5,75327
3PBgP 246 8,37375
3PvQP 246 7,63452
3THvx 275 9,31963
3WD4i 264 6,44159
3dSYZ 186 9,01637
3dnCG 274 9,43935
3kZKq 311 4,97673
3kZL4 246 5,15208
3kvLK 271 5,50221
3l0jl 309 4,91711
3l3Hz 300 4,94860
3lgl7 274 9,42652
3lgqj 247 4,72351
3lp6R 311 6,44409
3m4bl 247 4,74631
3m6RC 245 5,48129
3m7lD 312 4,92916
3md28 249 4,78285
3mdPm 301 4,88613
3mdbf 246 5,24564
3mfyF 308 4,71698
3mhx0 311 4,97673
3nNxq 263 9,06814
3nYZ2 264 9,13557
3o53P 236 8,64116
3oobH 263 9,52696
3p2Hi 310 4,88749
3pMhu 274 9,38964
3qhTK 246 5,12434
3r5RF 314 5,42928
3rWFY 248 5,21960
3rgH6 303 4,70908
3rsLu 308 5,41701
3ruC6 299 4,99822
3ruhy 301 4,93598
3runt 246 5,05551
3s3LG 308 4,89193
3sCBF 299 4,68543
3sHIr 246 5,25678
3sTGB 305 4,98338
3sYBV 309 5,53307
3sYPk 289 5,59804
3sYrH 246 5,11570
3sh3r 308 5,45162
3smE2 356 5,00492
3soSw 246 5,16151
3sobz 306 5,22483
3tCsG 195 5,96363
3tDKP 311 5,36415
3tDSw 305 4,78444
3tDbE 246 5,34925
3tEMQ 248 4,77893
3tKto 299 4,79479
3tNzA 246 5,06375
3tPMv 246 4,63206
3tRY9 301 4,92620
3tTan 249 4,76131
3tfnt 246 5,17078
3tiNq 245 5,21602
3tnio 304 5,25587
3txDw 284 4,99583
3txHN 246 5,34925
3u5SQ 246 5,33323
3u5X9 297 4,68793
3uYQm 247 4,83679
3uaRr 319 4,90506
3uc0h 300 5,02720
3ucag 246 4,99429
3umS2 246 4,74022
3v2zX 277 9,48454
3vIWQ 246 5,39291
3vJsZ 311 4,83492
3vKSJ 245 5,47379
3vM62 249 4,84231
3w8NU 249 4,99731
3wSsh 300 4,88846
3wfxa 300 4,90193
3wg6K 245 5,21608
3wjmu 313 5,36341
3wjqN 246 5,24370
3wk61 249 4,68719
3wl8b 246 4,60824
3wlfW 207 4,93478
3wmcK 299 5,21767
3wo19 250 4,90040
3x6ux 312 4,98867
3xIyC 246 5,15407
3xUFd 246 5,25683
3xvnb 312 5,34044
3xwKR 246 5,07370
3ya6A 303 4,86169
3yamo 365 5,00578
3yg8b 249 4,80548
3ykv7 308 5,24836
3ykwI 177 5,09308
3yloe 249 4,58022
3ylqp 246 5,73565
3ypPz 246 4,63206
3yuHy 246 4,98668
3yvfL 311 4,80053
3yxLS 310 5,00316
3yyi6 246 4,99429
45emE 245 6,81905
45qw9 335 6,17188
4kiG4 278 8,38987
4xBW4 247 6,39646
4xCTK 247 6,23839
4xp5d 222 7,08307
4xq48 272 9,21809
4y7zd 274 6,38463
4y96F 287 9,33523
4yiLh 245 8,04522
4ysqO 243 6,73931
5LRDl 254 4,76574
5LYuH 310 5,40479
5MHUe 266 9,06969
5MNsU 324 5,75957
5NDOS 308 4,74363
5OhpQ 266 9,21216
5Oqo7 246 4,97883
5PrZP 299 5,32908
5Qace 308 4,65508
5QdhP 312 5,64305
5QyxW 306 4,74682
5QzhT 317 5,20699
5R15f 301 5,20352
5RFCv 274 5,47026
5RHNy 302 4,92649
5RI2h 318 5,18226
5RVKp 303 4,99213
5RVbF 306 4,79644
5Rli0 308 4,72908
5Rpey 247 8,64020
5S8qh 271 5,38967
5SPzp 325 4,78888
5SZyO 274 9,37726
5Sh3u 250 5,02823
5ShkM 305 4,85413
5Swpw 306 4,85993
5T20Q 313 4,78189
5TjKP 266 9,29874
5UFDV 274 9,36495
5WUwA 300 5,00549
5WjyN 309 5,20204
5Xefi 246 5,02425
5XrI8 247 5,04460
5YScw 312 5,28844
5YdZX 246 5,12093
5YoAj 269 9,02933
5ZnR7 306 4,79644
5zEo 263 9,46610
6043W 334 5,98346
60KJ9 308 4,78911
60aem 313 5,42928
614e4 308 4,65417
61K8B 317 5,27156
61RFc 307 4,78507
61oRE 308 4,75318
62T2w 308 5,18982
62WVU 303 5,40456
62jRf 308 4,80229
62z4T 303 5,02419
638cV 266 9,18328
63xtr 167 8,83270
64Hvu 269 9,13319
64sJm 168 8,80150
64tc0 306 4,79644
65Bad 274 9,37726
65N92 309 4,79172
66FgL 266 9,19740
66Pl1 314 9,01334
66R2q 274 9,49795
67VS5 317 5,42923
68U2A 177 6,27334
68cTZ 308 4,75318
69JeI 246 4,97093
69nbC 269 9,12081
69t20 361 9,38326
6UJAy 257 8,26112
6UQ4X 198 6,69480
6adZL 307 5,56064
6ayQX 308 4,76256
6b4wO 311 4,98367
6bY4E 309 5,43747
6cbYH 247 8,78906
6dRji 313 5,18181
6dY7H 299 4,92012
6diUs 308 4,71033
6eCXr 308 4,74363
6ej0e 269 9,02946
6f35f 310 5,58934
6fDox 306 4,77683
6g7QB 246 4,80928
6hiuO 266 8,92618
6iLKM 274 9,38964
6isPi 247 8,78886
6iuMH 274 5,37711
6jBCd 311 5,34670
6jPOg 327 4,97628
6jXu8 256 8,78976
6k3Bt 306 4,64030
6kce0 267 9,19740
6lEso 318 4,76779
6mZ7F 315 5,86632
6nRCZ 308 4,70760
6nWG6 302 5,06483
6nY4s 270 9,40660
6nzbA 268 9,16935
6pDIy 301 4,66622
6pNM 262 5,80232
6pj18 266 9,09599
6q0OP 274 5,37711
6qIOd 302 5,11417
6qzCX 306 5,65641
6qzIh 317 5,98176
6rudV 308 4,91489
6ry4U 309 5,11701
6sAj0 269 9,02933
6sqkU 307 5,20278
6su4N 310 5,31470
6tCyR 308 4,69816
6tGbM 303 4,87652
6uBEm 246 8,78886
6uNhn 274 9,42639
6ubLc 309 4,80985
6wolQ 327 5,98818
6wyQ6 246 5,04124
71AUv 188 9,08638
7DI8b 310 5,38393
7Rbf4 311 4,87749
7WjP3 263 6,77398
7XqAF 247 8,71343
7YBwt 229 8,76830
80qPx 327 5,06154
83GLM 308 5,24132
83H1i 365 5,00578
84Lj8 314 4,82173
88nrk 271 5,30032
8eZqI 277 7,61616
8fi10 318 8,84908
8lyn6 247 8,86397
8mQs0 159 9,17490
8mQzh 267 9,13325
8mRaB 271 5,20738
8pAPo 247 8,43744
8qRoW 267 9,04261
8rFwb 276 9,16632
8rQVt 248 6,29056
8sicr 247 8,64020
8tg0w 215 9,06369
KGYG 274 9,31157
N6Iu 375 5,23762
NAB5 302 4,68242
Zs3u 310 9,45031
b1z2 312 5,13474
c9Ma 284 6,54850
mX9n 275 9,36856
nzQo 285 9,63907
o5gf 276 9,23685
obP9 233 7,08296
og3b 313 9,22995
ojBX 309 9,15769
ojYj 268 9,33787
omIu 285 9,43567
q9kn 209 9,12100
wNcj 274 9,38977
wOi4 243 4,80411
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_32070
5P7Lm
156 60,6% 249 5.301E-116
2 phalp2_39586
6nEZG
27 62,3% 199 2.088E-103
3 phalp2_19217
3vgRO
2 59,3% 182 6.376E-82
4 phalp2_35488
tqvH
739 43,0% 237 5.026E-70
5 phalp2_39111
2nYlj
83 41,1% 231 6.327E-66
6 phalp2_17183
3bJIf
458 38,2% 269 9.821E-61
7 phalp2_36672
45lpM
229 42,5% 207 8.014E-59
8 phalp2_34904
4jM8q
3 38,0% 184 1.860E-45
9 phalp2_8073
62PL1
35 31,2% 221 6.147E-36
10 phalp2_24288
3idhM
2 36,7% 166 4.876E-34

Domains

Domains
Representative sequence (used for alignment): 3Pylt (223 AA)
Member sequence: 3tunt (247 AA)
1 223 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01510

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3Pylt) rather than this protein.
PDB ID
3Pylt
Method AlphaFoldv2
Resolution 96.87
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50