Protein
- Protein accession
- 3r2yq [EnVhog]
- Representative
- 101m6
- Source
- EnVhog (cluster: phalp2_37067)
- Protein name
- 3r2yq
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MAILKPDTTTTMNGVTVNEYLLTKHNPNHIAMPSASMEGKIIGVTVHNTDWISVASGTTPAEQYTRATVNGNMKDVRVHYYVDNTCAWQNLPHSLSGWHAADGSGNGNRRTIAIECIMSSAYNVTDKKSEDNCARLAAALLKK
- Physico‐chemical
properties -
protein length: 143 AA molecular weight: 15563,4 Da isoelectric point: 7,77 hydropathy: -0,37
Representative Protein Details
- Accession
- 101m6
- Protein name
- 101m6
- Sequence length
- 303 AA
- Molecular weight
- 33527,42510 Da
- Isoelectric point
- 9,22422
- Sequence
-
MAFLIPDKIEVTPQGLTIKEYFLNAHNTNKISMPAKRQKNLIGVTLHNTDDIKEAAGTTDSEQYTRATINGNMGEARVHYYVDAKEAWRNLSDDYTSWHSATGGNGPGNSDTISIECIMSGKQTATDKTSMENAAKLIAYIFNKYGWTVDKNLYTHNYWTNWLATGKMLANHDTQSLAKVSPLTNKYDGTGKANPAGKYCPVYILPQWNAFKNLITQHQIGVSISVISTPAPSPSKFEPYLVIIAVDSLNYRKGPGSNYSVAGRVRRNEVYTIVEEATGSGASKWGKLKSGAGWISLDFIKRR
Other Proteins in cluster: phalp2_37067
| Total (incl. this protein): 139 | Avg length: 299,7 | Avg pI: 9,17 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 101m6 | 303 | 9,22422 |
| 11GB0 | 271 | 9,32685 |
| 13ArC | 301 | 9,41356 |
| 13D4g | 304 | 9,37075 |
| 13DOU | 252 | 9,85188 |
| 14HRU | 306 | 9,45224 |
| 153YR | 175 | 6,36667 |
| 1GooL | 264 | 4,86908 |
| 1keTe | 332 | 9,60226 |
| 1njGN | 339 | 9,38532 |
| 21Ft0 | 248 | 8,55929 |
| 2bMyZ | 264 | 4,81645 |
| 3KPHV | 338 | 9,52580 |
| 3TD2Z | 265 | 9,31106 |
| 3TGhw | 266 | 8,21838 |
| 3WD43 | 262 | 8,40824 |
| 3WJHb | 223 | 7,76565 |
| 3ZIb9 | 270 | 8,61983 |
| 3ZtiW | 266 | 8,20607 |
| 3e2Oe | 270 | 8,46491 |
| 3k4jf | 304 | 9,48016 |
| 3k4lu | 338 | 9,44528 |
| 3kQQq | 333 | 9,50530 |
| 3kWPx | 336 | 9,41317 |
| 3kab3 | 336 | 9,53695 |
| 3kftn | 338 | 9,69555 |
| 3kl02 | 304 | 9,25929 |
| 3l2QS | 336 | 9,50311 |
| 3l4zf | 334 | 9,37720 |
| 3lcsv | 338 | 9,41691 |
| 3ljRG | 334 | 9,45611 |
| 3ljWi | 331 | 9,50356 |
| 3lntV | 336 | 9,51574 |
| 3mb4e | 337 | 9,53844 |
| 3mb7I | 338 | 9,41317 |
| 3me2J | 305 | 9,42974 |
| 3mvDE | 304 | 9,54043 |
| 3mvEP | 338 | 9,52683 |
| 3mx4n | 338 | 9,55990 |
| 3nJ0S | 285 | 8,62240 |
| 3oaty | 303 | 9,41923 |
| 3pDfq | 334 | 9,51561 |
| 3pE24 | 337 | 9,40247 |
| 3pJ32 | 336 | 9,30938 |
| 3pTlE | 186 | 8,41082 |
| 3pa1K | 335 | 9,46655 |
| 3pbTD | 338 | 9,49189 |
| 3pmMv | 326 | 9,51632 |
| 3q0xc | 336 | 9,39190 |
| 3q1Ts | 336 | 9,41317 |
| 3reOm | 334 | 9,44567 |
| 3rfBR | 264 | 9,46217 |
| 3rgeI | 338 | 9,48080 |
| 3roKF | 338 | 9,52683 |
| 3rtTE | 331 | 9,64358 |
| 3sAvf | 313 | 9,46069 |
| 3sCOg | 306 | 9,52851 |
| 3sD3E | 222 | 8,56071 |
| 3sUZW | 326 | 9,57170 |
| 3scEo | 338 | 9,50291 |
| 3shRf | 267 | 9,56654 |
| 3shWB | 337 | 9,35483 |
| 3shrf | 304 | 9,57447 |
| 3sl01 | 340 | 9,53856 |
| 3slSH | 286 | 9,37127 |
| 3smGN | 337 | 9,41685 |
| 3snKJ | 297 | 9,29945 |
| 3snLU | 331 | 9,72224 |
| 3spHC | 221 | 9,28037 |
| 3t3JF | 336 | 9,49189 |
| 3tN71 | 332 | 9,32595 |
| 3tZkQ | 301 | 9,48029 |
| 3teSW | 305 | 9,40273 |
| 3tgvT | 358 | 9,66441 |
| 3ty2A | 331 | 9,65635 |
| 3u9RE | 217 | 9,09741 |
| 3uYLY | 222 | 9,02192 |
| 3uYOD | 304 | 9,54159 |
| 3ue0E | 303 | 9,39815 |
| 3ueBM | 338 | 9,54998 |
| 3ujDo | 304 | 9,58659 |
| 3vJ8M | 177 | 7,85156 |
| 3wNnh | 165 | 7,77491 |
| 3wYnd | 335 | 9,35470 |
| 3wcww | 326 | 9,56036 |
| 3x0kA | 338 | 9,41685 |
| 3xBcA | 336 | 9,49176 |
| 3xITe | 304 | 9,35161 |
| 3xam2 | 336 | 9,52703 |
| 3xrlv | 211 | 8,89962 |
| 3ycV5 | 334 | 9,44567 |
| 41pvD | 267 | 8,59533 |
| 41qOW | 235 | 8,81400 |
| 4L6It | 194 | 9,39377 |
| 4LaQq | 275 | 7,75712 |
| 4Vvdo | 339 | 9,55990 |
| 4k3qE | 322 | 7,17930 |
| 4yrS4 | 285 | 8,43280 |
| 4yrVb | 249 | 6,37275 |
| 5M0vZ | 237 | 9,61187 |
| 5Nzey | 188 | 8,92805 |
| 5Oy8K | 294 | 8,59539 |
| 5UbWI | 297 | 9,37185 |
| 5Vim3 | 338 | 9,56887 |
| 64c1q | 338 | 9,66634 |
| 68IKx | 236 | 9,55604 |
| 69dhm | 332 | 9,65557 |
| 69lNv | 304 | 9,35141 |
| 6Ze3n | 300 | 9,42684 |
| 6bVTX | 263 | 9,52761 |
| 6bbpy | 338 | 9,75215 |
| 6fHb8 | 304 | 9,49150 |
| 6s06K | 338 | 9,56010 |
| 71m9c | 251 | 8,68778 |
| 7UmYO | 331 | 9,28288 |
| 7UnL7 | 334 | 9,40686 |
| 7Unsw | 329 | 9,34381 |
| 7Untx | 298 | 9,47416 |
| 7yrEq | 335 | 9,49189 |
| 80rgY | 338 | 9,46655 |
| 81fkw | 294 | 9,70277 |
| 85i9k | 335 | 9,46107 |
| 86u0I | 232 | 8,68848 |
| 87xyS | 336 | 9,45398 |
| 88VmF | 331 | 9,55056 |
| 8Jmlk | 335 | 9,55791 |
| 8b1DQ | 295 | 9,40776 |
| 8cFR0 | 214 | 9,28056 |
| 8eWQT | 221 | 9,49395 |
| 8kY1u | 336 | 9,48061 |
| 8ldbQ | 331 | 9,57170 |
| 8lif0 | 296 | 9,22144 |
| 8ouIg | 304 | 9,54043 |
| 8pKgP | 303 | 9,39802 |
| 8pKhn | 336 | 9,53824 |
| 8qZ0Q | 326 | 9,61444 |
| oibK | 304 | 9,46404 |
| xrDa | 332 | 9,33478 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_36039
5QA7W
|
56 | 43,0% | 244 | 1.750E-110 |
| 2 |
phalp2_15172
oqn3
|
103 | 40,8% | 318 | 2.533E-86 |
| 3 |
phalp2_29147
7kPAJ
|
3 | 29,1% | 288 | 3.418E-47 |
| 4 |
phalp2_28224
ow2o
|
15 | 31,9% | 244 | 4.934E-45 |
| 5 |
phalp2_25539
3nQIY
|
6 | 29,1% | 271 | 8.801E-40 |
| 6 |
phalp2_20199
83ZcC
|
8 | 28,0% | 282 | 2.390E-31 |
| 7 |
phalp2_36261
3rB1
|
176 | 26,1% | 291 | 2.649E-26 |
| 8 |
phalp2_11225
6wIAx
|
104 | 26,5% | 298 | 8.486E-24 |
| 9 |
phalp2_11417
eYHn
|
21 | 27,0% | 218 | 8.486E-24 |
| 10 |
phalp2_14662
5ObrM
|
161 | 25,9% | 289 | 2.104E-23 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(101m6)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50