Protein

Protein accession
3j2aQ [EnVhog]
Representative
4zM0o
Source
EnVhog (cluster: phalp2_3543)
Protein name
3j2aQ
Lysin probability
99%
PhaLP type
endolysin
Probability: 83% (predicted by ML model)
Protein sequence
MSCTLKRFIVNNLGKKVDFDGTSGAQCVDLYRQYCKDVLGIPQTPALGVEGGAKDIWEKHGVLKQSEDSFAVGDILIYDKTPTNKYGHVCILAALLDSHTFIVFEQNGFDQSGAKLTVRNTTNLLGSLYK
Physico‐chemical
properties
protein length:130 AA
molecular weight:14275,1 Da
isoelectric point:6,81
hydropathy:-0,14
Representative Protein Details
Accession
4zM0o
Protein name
4zM0o
Sequence length
137 AA
Molecular weight
15978,05730 Da
Isoelectric point
9,16600
Sequence
MITLNQFINKYIWKQVDVDNYPSWDKTQCVDLLKKYYPEVLGVPAIRGDGGDYFANSPSTQFRKIYNSYWAIPRAGDVMVWKETSRLPFGHVAIVTSANLYTFTSFDQNWPSQTSPCMYVKHKYTGDYPVLGWLRKK
Other Proteins in cluster: phalp2_3543
Total (incl. this protein): 163 Avg length: 139,6 Avg pI: 7,77

Protein ID Length (AA) pI
4zM0o 137 9,16600
13eKr 134 5,50567
17iW3 128 5,64664
19clP 133 6,71839
1KsYw 134 9,24066
1M46z 136 9,04570
1NAAv 135 7,78322
1NxA7 135 8,50307
1XIXe 133 9,12842
1XOwL 145 9,69503
1cAWQ 136 6,40572
1cAZB 138 9,08206
1cCE4 138 9,08206
1cCxJ 136 8,46285
1cgyN 141 8,92508
1ckKX 135 5,89747
1ckTh 138 9,26116
1cq9A 141 6,29613
1cqa1 138 6,72294
1csIY 141 9,08181
1csWl 135 6,89726
1cyRp 141 6,15887
1e2A5 141 5,41905
1gGd0 133 6,71839
1jUMZ 133 8,69209
1jVgW 140 6,13358
1kmF9 147 5,81255
1kqIs 138 5,72826
1kqRY 136 5,55785
21uk7 146 8,23340
23Ct1 141 8,75566
23EE0 139 9,00141
23rUB 133 8,53215
23w7f 138 7,78167
23wwm 136 5,08279
24CJ5 138 8,35944
24Cgb 140 8,68043
24HwK 147 8,33133
2jnIj 148 6,73499
2lVxJ 160 7,70489
35Aoa 142 7,70500
35Auz 182 9,54076
35zKO 137 6,26766
35zOf 149 7,75553
38HBS 140 6,72123
38HWu 141 8,63510
38IOH 137 6,72129
38Kzk 137 8,44892
3PQhp 127 5,78123
3TDtC 135 7,80707
3TEiF 161 8,76913
3TK5r 139 6,81985
3TO8n 141 8,95409
3VL93 135 7,76804
3WAxZ 134 7,66817
3WDRr 138 5,54558
3WHit 133 6,71839
3WKUR 136 8,30915
3XbZU 189 7,61577
3ZHhT 139 8,83586
3ZML2 137 9,01805
3aqVh 138 6,83059
3araK 138 6,14557
3dQXj 141 8,93952
3dUiK 136 8,38993
3e3op 135 7,55125
3fOzN 135 8,84811
3gKay 137 8,52525
3gMND 135 8,46130
3gTKH 135 9,15769
3ga0j 137 6,09589
3h6sA 135 8,41217
3iCD1 138 9,03526
3iDeX 135 6,70907
3iZQY 134 6,72123
3ikD7 134 7,63390
3iknu 137 6,70754
3iom9 118 6,07838
3isaA 135 8,39180
3ivZK 136 7,60252
3j3qz 138 8,75566
3xJr7 159 6,82639
405EC 141 8,83122
4090Z 138 8,93972
40CWH 135 5,93953
40Dmi 136 6,70276
40Heg 137 7,60713
40Xm5 135 6,09242
40bqP 138 8,92650
40hwu 137 8,79860
40jch 135 8,63291
40k6f 134 9,03004
40kJp 141 8,74947
41dCY 138 8,26918
41eNq 141 7,61633
41hbw 148 8,88627
41ii7 137 8,52525
41pkf 139 9,18502
41rb3 137 8,52525
4GXbP 133 9,11565
4L9Cu 125 5,51682
4OdYA 134 8,31792
4OhE9 136 8,84347
4VYpN 159 8,64735
4gQrR 168 7,77293
4k9HY 139 8,26261
4k9LE 138 8,69248
4karj 139 5,93373
4kctz 133 7,69903
4khnh 125 6,70816
4xOVm 190 8,73800
676i 137 8,88344
67FB 136 6,71748
690M 126 6,55538
6Yob3 135 6,95740
6ZfX3 136 6,89641
6pQfQ 142 9,04964
70Ipo 142 8,79898
72X0k 138 7,64794
72X3Z 138 6,72294
75Wdg 138 8,71634
79pdo 139 9,09734
79peO 139 9,31750
7DKNb 136 9,05505
7DNQf 134 9,07923
7DOct 142 9,09734
7ICn2 142 6,30080
7JSl 147 7,64680
7K6g 151 7,60104
7Kd2 145 6,73186
7LkQz 137 9,01843
7OOgM 133 8,71724
7OcYF 135 6,06452
7bqM5 136 7,70676
812FG 140 6,81718
81MQI 139 8,81542
82RuS 135 9,20720
830R 141 6,73397
83HTN 184 8,39438
8f3l1 115 6,70924
8fiim 134 8,95803
8kSr0 134 8,31792
8lzFy 135 8,52706
8nYqV 143 7,66215
8rgoR 144 9,64578
8rpzQ 154 6,82172
923X 143 8,86925
BbUH 141 7,73194
HoAt 136 5,68165
O785 141 7,75002
OCJ1 135 6,06452
OhxH 141 9,37701
Oqh4 135 6,05849
f7qo 149 6,58374
oBho 138 9,09721
ouo5 142 8,39174
ovJG 153 7,77748
p3K7 135 6,06156
qgiB 135 6,50252
xpIe 135 6,06304
yqbk 168 9,29977
ys9t 133 8,62234
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_17703
71dZW
23 36,2% 138 1.373E-50
2 phalp2_24452
4BMZo
66 43,3% 143 7.484E-41
3 phalp2_30026
2tAM9
32 40,1% 137 1.461E-37
4 phalp2_39580
6iLgH
177 37,2% 145 1.892E-33
5 phalp2_34225
35z4C
4 28,6% 150 1.569E-31
6 phalp2_5557
3TDb1
10 32,8% 143 1.782E-29
7 phalp2_10799
3WA57
47 35,1% 145 7.847E-28
8 phalp2_11577
18WTO
29 28,3% 141 1.107E-24
9 phalp2_37199
1X3cR
12 30,5% 144 1.005E-23
10 phalp2_1580
81s3j
1 28,9% 121 3.546E-23

Domains

Domains
Representative sequence (used for alignment): 4zM0o (137 AA)
Member sequence: 3j2aQ (130 AA)
1 137 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF05257

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4zM0o) rather than this protein.
PDB ID
4zM0o
Method AlphaFoldv2
Resolution 96.84
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50