Protein

Protein accession
3e2gL [EnVhog]
Representative
3gdwj
Source
EnVhog (cluster: phalp2_9992)
Protein name
3e2gL
Lysin probability
98%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
VITGEQFAEKALTGGYIGIPYERLDCQGFVERVLADCGVRKPNGTVYDWRGSNAMYRNYFQWRGTVKECESKFGMIPQGALVFTRKTDGGEVERGYHDGLGNFSHVGIYVGAPHGVIHSTAGGVQYGKFPDAKRWTNVSLLSMIDYTHQNINNNSKDAKQIISEIRALLGKLEEVMKC
Physico‐chemical
properties
protein length:178 AA
molecular weight:19814,2 Da
isoelectric point:8,34
hydropathy:-0,39
Representative Protein Details
Accession
3gdwj
Protein name
3gdwj
Sequence length
178 AA
Molecular weight
19528,83490 Da
Isoelectric point
5,39637
Sequence
MISGKQIAKTAVNSGLIGTPYSKMDCQAFVEAVLEKAGLHIINYRGSNHMWRELVYDRQTVKGHIPPPGSLAFIVRNDGGEKKRGYNDDMQNATHVAIVIDAETVMESTTGGVQYGKLSRFTNYGLIKDIDYSEGGGEDAGERPTPIDPIDAIRETLDELKRTIAKLEVLINEAFGNT
Other Proteins in cluster: phalp2_9992
Total (incl. this protein): 191 Avg length: 224,8 Avg pI: 6,34

Protein ID Length (AA) pI
3gdwj 178 5,39637
191v 171 5,95158
1GRfG 178 5,74400
1GU2A 269 5,18607
1cM8x 279 5,28929
1cNne 173 8,43815
1gBO1 163 5,47993
1nYQY 166 6,65098
21BIo 259 7,62071
21F2D 345 5,38546
21Kal 191 7,04789
21hJl 179 7,73979
21jHn 336 5,49311
21m42 136 8,70931
21mvU 287 5,39268
21ngg 258 5,76247
21o8E 258 7,02851
21pam 288 5,65363
21rIa 179 6,96962
21rIh 185 5,95902
21rPS 279 5,03636
21rg1 195 5,37415
21ufH 186 8,80756
232Me 185 6,71765
239fy 330 5,15634
23Cvb 240 5,44918
23EiL 180 5,28702
23HFb 187 8,28349
23HjD 175 8,58669
23Io1 182 4,99833
23IwO 345 5,37961
23IzE 251 6,02575
23JWH 335 6,46097
23LUe 181 5,49618
23Lqv 282 8,14695
23NGA 238 8,89768
23NXN 187 5,75577
23O6O 180 6,29602
23Qot 182 5,07887
23Ria 179 6,40913
23Sb0 300 6,03928
23cb0 280 5,50505
23dc4 194 6,28738
23h0P 287 5,51244
23imb 290 4,91142
23rSQ 237 9,18322
23s5u 260 5,87314
23slP 196 6,82565
23tCU 177 7,69170
23zjQ 251 5,95362
24BOM 270 5,55342
24CKm 246 6,90767
24CPp 258 7,54023
24Gla 263 8,71646
24LNd 185 5,50886
24Lej 260 7,64032
24Lwi 192 6,96070
2fX2Y 192 5,53694
2fXxe 177 8,88402
2lvyQ 187 7,61679
2phlO 189 7,61474
38G0l 188 8,56471
38Kqd 270 6,82275
3GQf6 163 4,99077
3PXVF 263 8,86313
3TDbH 261 7,68926
3TI03 188 6,06236
3TIWo 178 6,31393
3TJFy 196 6,82832
3TKSq 178 6,58653
3TQ5i 297 5,01209
3TQEE 249 5,58684
3VI1s 286 5,19431
3WA8V 260 6,95086
3WDpw 165 6,40902
3WG2W 263 5,89957
3WIWM 195 6,51724
3WIX7 180 5,00322
3WJpf 180 8,34029
3WL0y 328 4,75267
3WMBX 180 7,66948
3WMz4 246 6,12562
3WO0H 188 6,15290
3Wyhx 180 7,71376
3Wzpy 186 5,77941
3ZBpa 289 4,43034
3ZO7V 274 4,85282
3ZS19 292 5,34613
3ZScn 279 7,64413
3ZTAG 294 5,36380
3ZXEp 294 5,07438
3ZXtQ 286 4,67833
3ZY6u 285 5,16305
3ZZys 326 4,91091
3Zvoh 275 4,99918
3bXA5 180 7,55660
3bYFE 185 6,09356
3dQ8I 195 5,40990
3dUDJ 165 6,40220
3dXkx 196 5,72735
3e230 181 6,78796
3fTbR 314 5,12150
3fXO2 284 4,87237
3g9xX 187 7,67681
3gLGg 313 5,13781
3gQP1 272 5,27866
3gZSS 288 5,28440
3h7LD 294 5,19670
3iXhw 188 8,70215
3if0T 272 7,53392
3ij9o 271 5,20545
3iqlw 288 4,71686
3nM3s 161 8,18299
3nxzl 163 7,93362
3o0Qx 254 6,90357
3s6pf 163 4,83503
3v6OY 186 8,56522
3vtFm 167 7,20419
401cT 300 5,22785
406mn 307 4,78149
409Ab 299 5,04880
40EpE 312 4,97190
40hAW 278 5,40786
412pT 279 6,84565
413nN 181 6,49285
414h3 261 5,65806
419EU 188 5,31401
41gp8 185 5,79368
41hXe 181 6,90676
41hbC 194 5,02510
41hcL 186 5,29298
41n4g 188 5,93992
41nDf 272 6,91125
41nSN 225 5,96999
41oLY 215 8,70228
41oke 277 5,67545
4L8cE 175 8,30013
4LcX9 260 6,88868
4LdrG 350 4,81764
4Leen 258 5,22131
4Mebq 189 8,34932
4MenQ 298 5,07449
4MfVA 312 4,95309
4OfRX 241 8,06043
4OhQW 299 4,66713
4k4y8 353 9,04977
4k5bW 310 4,86192
4k9ov 295 5,32703
4kaLM 294 5,05398
4kfoJ 181 7,61463
5LHMw 162 8,37098
5Rnh3 162 6,56964
5Rnh4 167 6,65081
5SWHM 162 6,47018
5URyu 161 4,74489
5YE1o 166 5,93731
5YfIA 188 7,67448
5rHi 135 8,83715
63mPO 160 4,83208
66MRs 175 6,57999
69O4o 167 6,31938
69WhY 167 7,87696
6dir4 162 6,06520
6e5yJ 163 4,96326
6h4Qz 167 5,85376
6j2hK 166 6,70037
6lXzY 162 6,21986
6lb2x 166 7,08227
6lwOB 162 6,56669
6ojds 168 4,90898
6prN1 164 7,86090
6qgKQ 163 4,65264
6rbyA 187 7,60212
6sGqH 190 5,66579
6srms 190 4,75426
6ttep 163 8,79292
6uVO5 168 4,72573
6vNVm 167 6,64382
6vXME 171 5,86927
71v0S 162 6,56356
7DJZC 303 4,77961
7DKkd 265 8,86184
7DOGL 286 5,54126
7DSSR 262 4,95132
7q0JD 309 5,86353
8nOYA 165 6,04690
8nZq1 165 6,28698
8naZK 161 5,44446
ZK6P 307 8,14224
cakM 186 8,58192
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_27188
3gPMT
1 24,8% 169 2.344E-31
2 phalp2_802
3u81S
2 25,3% 158 6.427E-23
3 phalp2_32200
6Xp2c
36 29,6% 125 2.885E-14
4 phalp2_19188
21sq0
12 25,7% 171 2.178E-12
5 phalp2_37239
3uEg6
13 27,6% 163 1.376E-09

Domains

Domains
Unannotated
Disordered region
Representative sequence (used for alignment): 3gdwj (178 AA)
Member sequence: 3e2gL (178 AA)
1 178 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3gdwj) rather than this protein.
PDB ID
3gdwj
Method AlphaFoldv2
Resolution 89.89
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50