Protein
- Protein accession
- 3e0x9 [EnVhog]
- Representative
- 41qFE
- Source
- EnVhog (cluster: phalp2_40071)
- Protein name
- 3e0x9
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MAYAETIINKAKSYVGYKESPPNSNSCVFNRDFYGYNVSGAAYPWCCTFVWDIFRMCGASSLFYNGNKTASCTAVLKWGKDSGQIVKDGQAGDLILFDWDGSGDADHIGFIECRNADGSYTTIEGNTQISGDQSNGGEVMERKRNSCIRAIIRPKYEVDYLEYRVTFKALDIFLGRLTVERQEQPGRVRDLKRYSLTQRAR
- Physico‐chemical
properties -
protein length: 201 AA molecular weight: 22680,2 Da isoelectric point: 8,11 hydropathy: -0,49
Representative Protein Details
- Accession
- 41qFE
- Protein name
- 41qFE
- Sequence length
- 230 AA
- Molecular weight
- 25884,94540 Da
- Isoelectric point
- 10,24269
- Sequence
-
MTATASQVMRIAKSQLGYKEKPSGSNKTKYGKAYGMNGTPWCAIFVWWCFKKANASELYFGGKKTAYVPTLADYYIEHKRIVKKTHGKLGDIVFFDFDHNGNSDHVGFVWKYLGNGWYKTLEGNTGVGNNANGGKVMFRKRHISQISRIARPKYKKVKATTKKKAVKKAYPTLRKGSKSKYVKAVQKKLKIKQDGIFGSKTEQAVKTFQKKHGLTADGVVGKKTWAKLLK
Other Proteins in cluster: phalp2_40071
| Total (incl. this protein): 139 | Avg length: 249,4 | Avg pI: 8,96 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 41qFE | 230 | 10,24269 |
| 13BtK | 238 | 9,35399 |
| 19amI | 234 | 8,99465 |
| 1ATrJ | 248 | 5,27826 |
| 1JgM0 | 256 | 9,07401 |
| 1KlVQ | 170 | 9,49505 |
| 1Nz9g | 298 | 8,03490 |
| 1ctgA | 295 | 9,45353 |
| 1cunW | 296 | 9,51136 |
| 1dRYY | 237 | 9,31177 |
| 1gGaK | 253 | 10,10099 |
| 1gID2 | 252 | 9,00528 |
| 1jD5J | 254 | 8,52809 |
| 1jE1R | 257 | 9,43097 |
| 1kXaJ | 233 | 8,13251 |
| 1kf82 | 249 | 9,10946 |
| 1kfIv | 250 | 9,71373 |
| 21mOm | 252 | 9,41092 |
| 21mUa | 244 | 9,53934 |
| 234Gz | 254 | 10,18660 |
| 23AYH | 236 | 9,44173 |
| 23EKS | 244 | 9,53934 |
| 23H9B | 313 | 10,01602 |
| 23Hkh | 236 | 10,33140 |
| 23ICH | 239 | 5,53267 |
| 23KSZ | 236 | 9,37913 |
| 23bMl | 306 | 9,34129 |
| 24mnM | 270 | 9,46694 |
| 2OOyr | 229 | 10,19015 |
| 2QxiY | 271 | 8,98614 |
| 2VipG | 223 | 9,96509 |
| 2dijt | 241 | 8,97034 |
| 2fZlS | 268 | 8,84908 |
| 38Jge | 250 | 10,05102 |
| 38LiE | 243 | 4,43176 |
| 3Asy5 | 241 | 8,21587 |
| 3Iaeg | 239 | 10,23876 |
| 3PNU0 | 303 | 9,81346 |
| 3PRb9 | 232 | 9,06814 |
| 3QxKi | 252 | 8,44653 |
| 3VG6T | 229 | 5,80999 |
| 3VHAt | 241 | 4,78263 |
| 3WBYF | 235 | 9,43780 |
| 3WBfx | 251 | 9,27321 |
| 3ZBYI | 252 | 4,37731 |
| 3ZGR8 | 226 | 8,69403 |
| 3a2Yf | 265 | 9,22144 |
| 3cRWN | 220 | 10,26229 |
| 3fGJE | 239 | 8,96957 |
| 3fIkN | 222 | 10,02846 |
| 3fMML | 252 | 9,16865 |
| 3gQA | 247 | 9,94626 |
| 3il89 | 240 | 8,58392 |
| 3lGQy | 232 | 9,63095 |
| 3lJLG | 275 | 9,47197 |
| 3lcMa | 232 | 9,74235 |
| 3lmDb | 232 | 9,66744 |
| 3nVb3 | 293 | 6,01984 |
| 3oXex | 232 | 9,74216 |
| 3onsN | 239 | 9,13693 |
| 3rhH4 | 248 | 8,28098 |
| 3vdII | 268 | 8,91915 |
| 3wONC | 248 | 7,05130 |
| 40gVt | 203 | 9,05692 |
| 40iOl | 232 | 4,79706 |
| 41qcX | 208 | 8,53995 |
| 4GOLi | 228 | 10,21761 |
| 4L3CW | 235 | 9,09715 |
| 4L7Ic | 250 | 10,10801 |
| 4jM9p | 239 | 4,62069 |
| 4kpHG | 314 | 6,30494 |
| 4ygkS | 293 | 9,58505 |
| 5D7n | 237 | 9,37984 |
| 5KPvu | 274 | 9,39196 |
| 5OZcG | 255 | 8,69261 |
| 5Qb4d | 241 | 8,69467 |
| 5QbtZ | 256 | 9,05460 |
| 5RTvp | 232 | 9,65822 |
| 5SMsu | 255 | 8,63124 |
| 5SowC | 300 | 9,39686 |
| 5TTLH | 249 | 9,10914 |
| 5UxsX | 300 | 9,43554 |
| 5Y8Di | 239 | 9,26103 |
| 5Ygw3 | 238 | 9,24169 |
| 5hYNz | 310 | 9,03777 |
| 5hYQ3 | 304 | 9,11108 |
| 5vKO | 328 | 8,81201 |
| 5zJae | 172 | 9,37436 |
| 5zyU9 | 242 | 7,91287 |
| 60nRk | 237 | 9,19482 |
| 617pe | 241 | 8,84663 |
| 61GjS | 295 | 9,54585 |
| 638DL | 241 | 9,14602 |
| 64Xqp | 232 | 9,76936 |
| 64iOB | 241 | 9,05525 |
| 67gPH | 249 | 7,68914 |
| 67m2a | 234 | 9,67388 |
| 6HzEt | 268 | 9,18251 |
| 6LjKG | 269 | 9,44831 |
| 6QhWE | 240 | 9,47165 |
| 6TJ9G | 252 | 7,10308 |
| 6UL98 | 215 | 6,19712 |
| 6WgPk | 232 | 10,12162 |
| 6WgiG | 226 | 9,87109 |
| 6dYit | 232 | 9,70367 |
| 6diwT | 275 | 8,87815 |
| 6dluU | 232 | 9,72604 |
| 6fsD8 | 225 | 9,27444 |
| 6jFOY | 300 | 9,52651 |
| 6jc4E | 241 | 9,06524 |
| 6kEsV | 232 | 9,71115 |
| 6nFHi | 248 | 7,50976 |
| 6nqeq | 255 | 8,89736 |
| 6o6QL | 232 | 9,61193 |
| 6prFF | 303 | 9,47184 |
| 6qd2P | 300 | 9,40705 |
| 6wf0x | 276 | 10,06514 |
| 6wicg | 340 | 9,21841 |
| 71u2H | 260 | 9,82538 |
| 7DSmk | 264 | 9,63024 |
| 7DWYg | 236 | 8,58746 |
| 7xDcj | 232 | 9,70347 |
| 7xXbV | 232 | 9,71688 |
| 804mt | 217 | 9,59800 |
| 87o1J | 159 | 8,73355 |
| 88cz0 | 171 | 9,37404 |
| 8cC27 | 255 | 8,47490 |
| 8herF | 241 | 9,36476 |
| 8lA0u | 225 | 9,34355 |
| 8lW5O | 252 | 9,30061 |
| 8lmce | 249 | 9,10914 |
| 8mNbD | 232 | 9,78051 |
| 8mkcx | 300 | 9,33601 |
| 8nhrN | 306 | 9,39209 |
| 8ptjy | 239 | 10,09738 |
| 8vSWn | 241 | 9,51684 |
| N2p8 | 238 | 9,45037 |
| ori3 | 230 | 10,05431 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_1568
7XJtL
|
188 | 44,0% | 254 | 3.790E-80 |
| 2 |
phalp2_16018
3yVVm
|
206 | 42,2% | 161 | 3.729E-61 |
| 3 |
phalp2_18705
oeYw
|
31 | 44,5% | 155 | 3.050E-56 |
| 4 |
phalp2_35099
5iIaS
|
1391 | 35,0% | 251 | 3.390E-54 |
| 5 |
phalp2_33085
4F3tD
|
1 | 34,7% | 236 | 8.696E-54 |
| 6 |
phalp2_33264
5Ekx7
|
97 | 45,1% | 155 | 3.053E-53 |
| 7 |
phalp2_7242
3OKiC
|
1 | 42,1% | 152 | 7.047E-52 |
| 8 |
phalp2_32427
U2OC
|
884 | 43,3% | 150 | 6.340E-51 |
| 9 |
phalp2_15842
4jgCc
|
1 | 32,7% | 235 | 5.701E-50 |
| 10 |
phalp2_24157
2dFjl
|
298 | 42,8% | 147 | 1.068E-49 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(41qFE)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50