Protein
- Protein accession
- 3dZg3 [EnVhog]
- Representative
- 8pvH4
- Source
- EnVhog (cluster: phalp2_19324)
- Protein name
- 3dZg3
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 95% (predicted by ML model) - Protein sequence
-
MSIKFKGRLTPHFTAEEYSTGVENAVLTRESYLFAWVLEDTRTDVGLKFYVNSWYRTKKLNESVGGIPTSNHLRGCACDFHLTNKVTRARFVKIVKAFKRFCKKYKVVGEAGLYDTFIHLGFQNEAQIRANGGKFVQWDFRNGHELYDNIEELKD
- Physico‐chemical
properties -
protein length: 155 AA molecular weight: 17984,3 Da isoelectric point: 9,24 hydropathy: -0,46
Representative Protein Details
- Accession
- 8pvH4
- Protein name
- 8pvH4
- Sequence length
- 141 AA
- Molecular weight
- 16011,25360 Da
- Isoelectric point
- 9,24627
- Sequence
-
MAYKVDGKVTAHFSIDEMCNPSCGESTKLVLSPEAIEHAQMMEELRVWYNKPMTVNCWYRSKTWNAKVGGNAKSGHLYARATDIKLAGLTDAQFKNFAKKWAEICKKHGKIGEIGRYSWGIHFGSAAELYGMSKFYTFDKR
Other Proteins in cluster: phalp2_19324
| Total (incl. this protein): 112 | Avg length: 153,2 | Avg pI: 8,85 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8pvH4 | 141 | 9,24627 |
| 1HNvk | 161 | 7,93711 |
| 1jBcf | 150 | 9,84434 |
| 1jGHk | 152 | 9,51929 |
| 1kcy7 | 151 | 9,93221 |
| 1krNy | 149 | 9,14028 |
| 21hIx | 160 | 8,39677 |
| 21saC | 151 | 9,38017 |
| 233wk | 161 | 9,55294 |
| 23IOm | 157 | 8,94997 |
| 24DSa | 160 | 8,73245 |
| 2Vkz4 | 160 | 8,74612 |
| 2yHI | 161 | 8,92844 |
| 35d0J | 131 | 5,37347 |
| 38FwD | 169 | 9,67382 |
| 3PHi4 | 136 | 9,41537 |
| 3PYRp | 139 | 6,18979 |
| 3ZM9M | 153 | 9,38384 |
| 3ZQrG | 155 | 8,92670 |
| 3Zriv | 159 | 9,68343 |
| 3ZtK3 | 157 | 5,60162 |
| 3bXtO | 160 | 8,50675 |
| 3dNls | 158 | 9,28127 |
| 3dPVu | 156 | 9,42826 |
| 3dTGg | 159 | 9,44650 |
| 3e0St | 148 | 9,85685 |
| 3e3Gb | 158 | 9,40305 |
| 3fP9W | 153 | 9,40234 |
| 3fPQO | 161 | 5,61651 |
| 3geu2 | 139 | 9,56300 |
| 3nIxk | 139 | 6,94995 |
| 40G32 | 162 | 8,86983 |
| 40k6Y | 152 | 9,40234 |
| 40kmS | 161 | 5,38154 |
| 41kWg | 157 | 8,94997 |
| 41qu7 | 159 | 9,76001 |
| 45fPi | 141 | 6,36582 |
| 4FVBh | 154 | 5,52523 |
| 4Mh44 | 153 | 9,31899 |
| 4UWQI | 136 | 7,82003 |
| 4V7RI | 153 | 6,50701 |
| 4Xhbh | 140 | 7,88089 |
| 4aCK | 146 | 9,18599 |
| 5Nz0g | 161 | 8,56335 |
| 5PfLi | 168 | 8,82632 |
| 5Pmao | 150 | 9,68381 |
| 5QaOy | 150 | 9,65744 |
| 5V83G | 161 | 9,00135 |
| 5e25a | 162 | 8,89820 |
| 6adQ | 157 | 9,14170 |
| 6cuFn | 149 | 9,51697 |
| 6dGmJ | 150 | 9,68381 |
| 6gDVR | 150 | 9,55449 |
| 6gvmr | 161 | 9,01540 |
| 6hibD | 161 | 9,03023 |
| 6jD7R | 156 | 9,59265 |
| 6kbE4 | 150 | 9,47074 |
| 6lzBP | 149 | 9,69703 |
| 6o1yH | 151 | 9,64462 |
| 6ppm | 144 | 9,16935 |
| 6vLY2 | 163 | 9,73674 |
| 7DKqr | 175 | 9,28391 |
| 7DQ7y | 162 | 7,67334 |
| 7VZIJ | 152 | 9,67343 |
| 7WCJL | 150 | 9,61012 |
| 7Wjwm | 150 | 9,65287 |
| 7X0eU | 161 | 9,01540 |
| 7Yqvs | 138 | 7,80295 |
| 7ZQ1n | 147 | 9,40763 |
| 80OsZ | 150 | 9,36179 |
| 83DWv | 147 | 8,92753 |
| 84SyA | 142 | 8,94043 |
| 84TEi | 150 | 9,13983 |
| 84TV0 | 150 | 9,27747 |
| 84U1i | 153 | 9,51890 |
| 84bLv | 153 | 8,94152 |
| 84uBp | 153 | 6,65576 |
| 85NZD | 141 | 9,14208 |
| 85OpV | 150 | 8,90703 |
| 86eGv | 142 | 8,64490 |
| 87rro | 150 | 9,25594 |
| 88SZk | 154 | 9,09644 |
| 8bLQe | 152 | 9,57531 |
| 8bsIQ | 181 | 7,72041 |
| 8fAyJ | 156 | 9,37069 |
| 8fBa1 | 148 | 8,59862 |
| 8fCoI | 163 | 9,23002 |
| 8fKu8 | 152 | 9,65074 |
| 8knQG | 161 | 9,14163 |
| 8miId | 159 | 9,76047 |
| 8miNV | 155 | 9,77149 |
| 8mkns | 163 | 8,21961 |
| 8mp7L | 150 | 9,38384 |
| 8n54Y | 151 | 9,46997 |
| 8n9Nx | 189 | 9,43941 |
| 8n9na | 150 | 9,51922 |
| 8nalb | 149 | 9,11849 |
| 8nbPE | 151 | 9,32485 |
| 8pHAM | 150 | 9,27747 |
| 8pYng | 150 | 9,40757 |
| 8pYtL | 151 | 8,92702 |
| 8pYvp | 149 | 9,30048 |
| 8qRhB | 151 | 8,94707 |
| 8rjY3 | 151 | 8,63059 |
| 8s0Ju | 149 | 9,25542 |
| 8s0mP | 151 | 9,35090 |
| 8s1FK | 150 | 9,13989 |
| Zqmq | 157 | 6,58408 |
| nJpV | 142 | 9,15195 |
| nL24 | 149 | 6,95291 |
| A0A8S5V3F0 | 150 | 9,27792 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_4740
7DNHd
|
3 | 27,4% | 135 | 6.757E-28 |
| 2 |
phalp2_29133
79Li3
|
3905 | 31,8% | 135 | 1.069E-22 |
| 3 |
phalp2_3181
8qBIB
|
378 | 27,2% | 136 | 1.817E-21 |
| 4 |
phalp2_24996
FFK4
|
307 | 27,2% | 110 | 4.718E-18 |
| 5 |
phalp2_26475
23cct
|
2 | 21,4% | 135 | 1.091E-16 |
| 6 |
phalp2_11058
4UnMN
|
68 | 27,3% | 117 | 9.815E-16 |
| 7 |
phalp2_31253
8iiIi
|
370 | 29,6% | 128 | 9.815E-16 |
| 8 |
phalp2_34553
7OdA8
|
10 | 32,5% | 135 | 9.815E-16 |
| 9 |
phalp2_38763
1dS3s
|
1408 | 28,0% | 121 | 1.838E-15 |
| 10 |
phalp2_1343
17yCd
|
10947 | 25,2% | 99 | 8.816E-15 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8pvH4)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50