Protein
- Protein accession
- 3dTAt [EnVhog]
- Representative
- 3gXLa
- Source
- EnVhog (cluster: phalp2_14261)
- Protein name
- 3dTAt
- Lysin probability
- 97%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MRLIKELVIMALCIGFGIVIHGSVLAWKESYEEPKQPEVITEYVYIESEPEVVVEYVYLPSTEDSFRNFTAKEEWCLCDLGMREAENQGVIGQCWVMYCGLCRCEAYGQSIEEMWESKAFASSMCRSGKTPNEDCLKALELIREGWTPKPLWFRAGHYHDFGNPLCQVGNHCFSMK
- Physico‐chemical
properties -
protein length: 176 AA molecular weight: 20245,1 Da isoelectric point: 4,90 hydropathy: -0,17
Representative Protein Details
- Accession
- 3gXLa
- Protein name
- 3gXLa
- Sequence length
- 173 AA
- Molecular weight
- 19862,53400 Da
- Isoelectric point
- 4,62569
- Sequence
-
MERIKQLIIMGLCILFGIIIHGSVEAWSTPEPEVITKTEYVYIETEPILETEYIYIPYQEDFFLNLTDEECNLLEQIAYAEARGEGTIGMMLVMNVVINRSQKTGKSIKEVIYAPNQFYTAGMTPNVSEDCHEALALVLDGIDESQGALFFNKYGYRKGCEPLFQYKNHYFSR
Other Proteins in cluster: phalp2_14261
| Total (incl. this protein): 121 | Avg length: 184,9 | Avg pI: 4,71 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 3gXLa | 173 | 4,62569 |
| 138jV | 194 | 4,54242 |
| 13Awf | 194 | 4,27630 |
| 13CRe | 204 | 4,26573 |
| 14W4F | 174 | 4,47899 |
| 153Li | 143 | 4,41005 |
| 19g9k | 172 | 4,63496 |
| 1Gsyl | 209 | 4,64229 |
| 21BTy | 188 | 5,25422 |
| 21Izj | 183 | 4,57130 |
| 21TNY | 194 | 4,27602 |
| 21qu3 | 185 | 4,99634 |
| 21riX | 188 | 4,57380 |
| 23Pqy | 185 | 4,97991 |
| 24Br1 | 186 | 4,53072 |
| 38GfN | 185 | 4,76472 |
| 38OfR | 179 | 4,52043 |
| 3KR3m | 191 | 4,38413 |
| 3TDNX | 186 | 4,73937 |
| 3TESV | 176 | 4,41255 |
| 3WC67 | 188 | 4,39595 |
| 3WJ7e | 184 | 5,08882 |
| 3ZIXy | 172 | 4,65809 |
| 3ZN6d | 173 | 4,39794 |
| 3ZOwj | 178 | 5,10024 |
| 3Zss8 | 181 | 4,79024 |
| 3Zxsl | 164 | 6,29761 |
| 3ZzF9 | 174 | 4,72636 |
| 3e0XN | 186 | 4,73937 |
| 3fQnL | 176 | 4,51514 |
| 3fQs0 | 174 | 4,69805 |
| 3gL6W | 235 | 4,66696 |
| 3gPHr | 173 | 4,67497 |
| 3gU3a | 187 | 4,62711 |
| 3h5Ki | 159 | 5,93731 |
| 3iC7w | 186 | 4,79081 |
| 3iDZ6 | 152 | 4,97508 |
| 3iuKB | 185 | 4,70237 |
| 3ixFq | 171 | 4,75040 |
| 3iy8N | 184 | 5,39001 |
| 3lnk4 | 195 | 4,46728 |
| 3m9RA | 195 | 4,46541 |
| 3nTxz | 196 | 4,60358 |
| 3qTqV | 195 | 4,37532 |
| 3tisD | 191 | 4,38413 |
| 3vAqw | 192 | 4,53992 |
| 3xHWF | 195 | 4,53168 |
| 3xzYO | 191 | 4,58380 |
| 3yeg5 | 195 | 4,42733 |
| 3yxcq | 195 | 4,58358 |
| 405LY | 178 | 4,53873 |
| 4095U | 186 | 4,55260 |
| 40ZAk | 176 | 4,63337 |
| 40dnR | 178 | 5,00424 |
| 40kyj | 179 | 4,72511 |
| 411ME | 177 | 4,40215 |
| 412nk | 155 | 5,45782 |
| 41bIl | 178 | 4,63729 |
| 41c8D | 176 | 4,54737 |
| 4FR3x | 163 | 4,36764 |
| 4FY0W | 179 | 4,39811 |
| 4L1UI | 159 | 5,50778 |
| 4L9HT | 168 | 5,49749 |
| 4LctD | 209 | 4,67406 |
| 4Ocbx | 181 | 4,71720 |
| 4k2YN | 176 | 4,99782 |
| 4k9eH | 204 | 5,29975 |
| 4kcUV | 179 | 4,61796 |
| 4kiAv | 172 | 4,82946 |
| 4kmzX | 175 | 4,75057 |
| 4yd1T | 164 | 4,64536 |
| 5C0dd | 178 | 4,08487 |
| 5KpFN | 191 | 4,61785 |
| 5Q2yH | 191 | 4,55919 |
| 5Sr4p | 191 | 4,33303 |
| 5SyMM | 189 | 4,31467 |
| 5TlQ9 | 197 | 5,20261 |
| 5U6yX | 194 | 5,10428 |
| 5Z1Kk | 191 | 4,61785 |
| 5ZntH | 194 | 5,32351 |
| 5ZzHU | 175 | 4,55141 |
| 60ZRt | 194 | 5,09297 |
| 64clH | 191 | 4,47848 |
| 64uqS | 191 | 4,76620 |
| 66gQs | 194 | 5,10428 |
| 68YJm | 191 | 4,46211 |
| 68rIJ | 178 | 4,08487 |
| 695LN | 191 | 4,55919 |
| 69N4o | 180 | 4,34053 |
| 6YvZm | 173 | 5,21381 |
| 6ZFwj | 196 | 4,60404 |
| 6Zoh4 | 183 | 5,87064 |
| 6bJF5 | 175 | 4,35571 |
| 6e8CE | 191 | 4,67889 |
| 6lA1N | 199 | 4,50520 |
| 6mtPZ | 178 | 4,21941 |
| 6njkC | 178 | 4,17689 |
| 6oYzl | 189 | 4,46728 |
| 6oqRA | 189 | 5,14611 |
| 6pXOi | 191 | 4,48951 |
| 6rewC | 215 | 4,95542 |
| 6uSZE | 202 | 4,65855 |
| 6vF83 | 191 | 4,77797 |
| 6vJPV | 189 | 4,46728 |
| 71hFl | 190 | 4,47911 |
| 7DP6n | 186 | 4,91432 |
| 7DP77 | 186 | 5,03363 |
| 7JDW4 | 175 | 4,38288 |
| 7Llho | 163 | 4,82372 |
| 7MVI7 | 189 | 4,58431 |
| 7VXr7 | 195 | 4,42721 |
| 7Vbo8 | 192 | 4,39868 |
| 7Zyux | 220 | 6,24367 |
| 7aLpo | 165 | 4,33724 |
| 8kQeJ | 191 | 4,38413 |
| 8naer | 221 | 4,25186 |
| 8pHHB | 209 | 4,67344 |
| 8vsJY | 189 | 5,06671 |
| OLfl | 173 | 5,09228 |
| z8xk | 191 | 4,38413 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_35863
4LekR
|
9 | 42,0% | 169 | 2.501E-56 |
| 2 |
phalp2_21750
3Q2vo
|
389 | 39,6% | 154 | 2.597E-37 |
| 3 |
phalp2_9804
8oqJz
|
6 | 40,5% | 116 | 4.928E-34 |
| 4 |
phalp2_32889
3iANo
|
281 | 33,5% | 146 | 1.733E-33 |
| 5 |
phalp2_33822
1kYXn
|
17 | 36,7% | 128 | 3.622E-31 |
| 6 |
phalp2_3540
4yvcs
|
35 | 35,6% | 132 | 7.541E-29 |
| 7 |
phalp2_1335
14NLd
|
89 | 30,9% | 168 | 9.195E-25 |
| 8 |
phalp2_34905
4k7zF
|
37 | 31,1% | 135 | 1.258E-24 |
| 9 |
phalp2_29561
40ZMT
|
29 | 29,6% | 162 | 1.378E-22 |
| 10 |
phalp2_19006
135l5
|
10 | 35,7% | 123 | 1.231E-21 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(3gXLa)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50