Protein

Protein accession
3b2ne [EnVhog]
Representative
hWzW
Source
EnVhog (cluster: phalp2_17848)
Protein name
3b2ne
Lysin probability
99%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
MAISRITGTQAFSHMNVWRLNEKNGFLGYCHRTCQNAWGLPPKYESAIDAWNHVPKQHRHTDPTKAPIGSPHFWEGGLYGHVALQSDKKDVVITTDAPRPNYIGLEHMDFFTKNWGKKYLGWASQYNDVDLQLGKMPS
Physico‐chemical
properties
protein length:138 AA
molecular weight:15768,6 Da
isoelectric point:8,89
hydropathy:-0,67
Representative Protein Details
Accession
hWzW
Protein name
hWzW
Sequence length
131 AA
Molecular weight
14298,85310 Da
Isoelectric point
9,12397
Sequence
MRDNVNAVIAWSRAEMHAPSRDWSGMCQSHCRSAYGVPAWSDSALHAWGKIPPHHKHAGGDPADAPRGAILYYSGGKYGHAALAIGNDGKNCLSNDYAHRGKIGLAPRTFPRWGLHYLGWSSWTPSGELHL
Other Proteins in cluster: phalp2_17848
Total (incl. this protein): 180 Avg length: 139,0 Avg pI: 9,50

Protein ID Length (AA) pI
hWzW 131 9,12397
12BbA 138 9,51826
12DWA 137 8,81787
12IF8 138 9,27489
12PO0 138 8,44860
16rM2 156 8,05379
17DLm 137 8,55626
17Kyx 130 9,77929
17Mup 138 8,88879
17NhB 138 8,56413
17ReM 138 8,88879
17SJu 136 9,54778
1885w 136 9,64629
18Jzo 131 9,40724
18PUW 138 9,09934
18bzn 138 9,12203
18fef 138 9,00470
19W34 128 9,69735
1E8nE 135 10,31889
1JHLS 129 9,67137
1JoxM 139 9,72913
1Kb7w 129 9,72398
1KcSV 140 9,84821
1Ke6p 138 10,17261
1aCL9 157 10,09254
1cQ5z 138 9,85852
1jovm 143 9,71450
1o8xU 147 9,51503
1o8zP 147 9,29952
1tMtN 130 9,69780
1zcC3 130 9,81049
22WcK 139 9,70999
24OhE 164 9,58582
2T9GM 131 6,54373
2T9zF 131 6,47234
2ZBX0 138 9,30190
2cLAV 154 9,71456
2cPqE 147 8,58772
2iF7L 138 9,56848
2iGj2 138 9,49002
2iLo9 138 9,51710
30CYm 138 8,88789
30TIG 140 8,92992
30UR8 136 9,92093
30YVH 140 8,95319
30ZJR 136 8,90884
30vCB 145 9,39312
30zFl 139 9,05267
31443 138 9,05757
315MB 146 9,39209
3195E 137 9,09902
32MIs 128 9,75737
36LVE 128 9,66699
371Yh 139 9,72862
37bA4 133 9,58131
37u0A 134 9,49079
37vAY 138 9,54353
38jRE 138 10,12426
3AnF5 139 10,11839
3T7mW 132 8,48219
3b1q9 157 8,56110
3b2sW 140 8,95319
41QTU 138 9,85910
443Dt 129 9,51046
46GrL 157 6,69190
46XWd 137 8,88866
46hFd 138 9,85852
474x2 139 8,88834
47AP9 128 9,69735
47Ady 134 9,79089
47Cge 138 9,33001
47FQY 138 9,14795
47fKb 136 9,64629
47psx 138 8,55607
47pzT 136 8,57141
47vff 140 8,93050
48juG 138 7,82706
490qj 140 9,27502
490wt 138 9,43986
497Ye 139 9,57331
49b0w 128 9,69735
49fyP 138 9,93543
49jAX 128 9,85794
4AavW 138 9,97669
4BXyk 140 9,66318
4BY6c 138 9,90146
4DO17 146 9,90694
4Jbpn 136 9,12171
4NO2t 170 9,48003
4NRgb 119 9,81152
4Oqcw 129 9,93414
4a0zX 144 9,78812
4aE5U 128 9,66653
4ap5R 139 9,76627
4bHNJ 136 9,45082
4bHfH 130 9,75737
4bQiw 139 9,69348
4bVog 128 9,75737
4bWxj 134 9,65441
4bg8F 138 9,93543
4bwuj 136 9,45044
4e2hK 166 9,48989
4gjZV 138 9,54076
4gpbi 140 9,66370
4nnX8 99 10,55053
4o8Kw 135 10,47445
4oBFy 138 10,08062
4odPb 138 9,94123
4oo3N 138 9,85910
4rCUW 138 9,85910
4rnQ6 138 9,57331
4vQyj 166 9,53715
51Q4b 138 10,04380
53YDE 138 10,11362
56CKm 138 7,67027
577HA 138 10,04013
57Liq 138 9,90913
57a18 140 9,72546
58ENp 139 9,47358
58V7p 139 9,60845
58s33 129 9,90204
59ipP 138 9,85910
5AyIv 138 9,85910
5ax61 128 9,81152
5eZJm 129 9,92712
5hKkK 170 9,32156
5j3hb 170 9,45224
5o3nl 138 9,94065
5vTmn 140 9,89720
5wFmP 140 9,72552
5xNgW 138 9,89237
5xrTx 138 9,85910
6Jn7O 163 9,53747
6Jyon 149 9,15891
6Kcpb 140 9,93298
6M3WG 135 9,96367
6OO2A 173 9,69290
6VyWj 141 9,70954
6xdVR 138 9,84473
7JWPp 140 9,81281
7Y1KU 138 9,62347
806wB 132 9,51059
87Uhs 170 9,56887
87ujv 138 9,94065
87upB 138 9,87051
87vIJ 128 9,89114
8bL8i 138 9,85910
8dZ3v 143 9,81281
8mVbg 138 9,57847
8mvxk 128 9,79038
8mzNj 138 9,75112
8nmi5 129 9,77110
8nn1c 144 10,10047
8rWLh 139 9,69348
8rgbj 182 9,65648
8rtJg 138 9,69477
8sFSo 138 9,65712
8sc5o 140 9,81281
8srF3 138 9,65712
8sstv 140 9,72552
8vLEo 167 9,70954
8vTnu 180 9,51129
Ax8g 130 10,02524
C7LI 129 9,72398
CeHZ 128 9,79038
Cfo4 128 9,66653
CgM2 139 9,65661
GQrs 133 9,57151
IWLV 135 9,95084
RLy2 138 8,88789
RNJw 138 8,41449
RWBH 134 9,49079
RXHy 138 9,51897
Sgjl 128 9,69735
UffJ 134 9,69787
ZPS0 138 8,86900
fWaO 135 11,17206
hUqQ 138 9,93543
x92m 132 9,84885
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_294
6K8ux
4 37,5% 133 2.108E-37
2 phalp2_8525
1q2M8
1 33,8% 130 4.882E-29
3 phalp2_14047
7ZnfK
1 28,6% 143 5.555E-27
4 phalp2_33437
75ODu
11 34,3% 134 3.811E-23
5 phalp2_28604
89LNO
4 29,7% 138 1.844E-22
6 phalp2_15584
15HTr
10 25,7% 136 5.372E-20
7 phalp2_12596
1o9Iy
9 26,5% 98 6.680E-19
8 phalp2_3148
8dGzQ
4 26,7% 116 9.154E-19
9 phalp2_1660
8hB0T
10 32,7% 107 3.227E-18
10 phalp2_13741
6Igr0
2 33,0% 112 5.487E-17

Domains

Domains
Unannotated
Representative sequence (used for alignment): hWzW (131 AA)
Member sequence: 3b2ne (138 AA)
1 131 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (hWzW) rather than this protein.
PDB ID
hWzW
Method AlphaFoldv2
Resolution 97.49
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50